KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0137Help
Entry
BLJ_0137          CDS       T01240                                 

Definition
(GenBank) hypothetical protein
  KO
K12510  tight adherence protein B
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Brite
KEGG Orthology (KO) [BR:bll00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bll02044]
    BLJ_0137
Secretion system [BR:bll02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   BLJ_0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSF
Motif
Other DBs
NCBI-ProteinID: ADG99630
UniProt: D6ZXI4
Position
177974..178630
Genome map
AA seq 218 aa AA seqDB search
MMWCAVLVALAVLIWPGNKSGRLYRLAYRGRAVDSAAINEPRYADSPRVGVAQVITSAIA
RLRGGGTLVEAFEEQSSRRFATHRITVERLITVFEQRRLPDESPAQVLEAARGVAAAAVL
SDELGCQAVPCLEAVLTAYRQMRLMQNLRSQACAVPKATVGLLSALPAVTVALGELLGAR
PLAFLLGSPRGVVCLTLGGCCYAAGLAWMRALLKGSGL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggtgtgctgttctggtggcgctcgccgtgctgatatggccggggaacaagtcc
gggaggctgtaccggctggcttaccgcgggcgcgcggtcgattccgcagccataaacgaa
cctcgatatgccgactcacctcgcgtgggcgttgcgcaggtgattacgtccgccatcgcg
cgattgcgaggtggcggcacattggttgaagcattcgaggaacaatccagcagacgcttc
gccactcatcgcattactgtggaacggctcataacggtgttcgaacagcggcgtctgccc
gacgaatcaccagcgcaggtacttgaagctgcacgcggggtcgccgccgcagcggttttg
agcgatgagctcggttgccaagcggtgccatgtctggaagcggtattgactgcttaccgg
cagatgaggctgatgcagaacttgcgatcgcaagcatgtgccgttcctaaagccactgtg
gggctgctgagcgcgcttccggccgtcactgtggcattgggcgagcttctgggagctaga
ccattggcgttcttgcttggatcgccacgcggtgtggtctgcctgacattgggaggatgt
tgttatgctgccggcttggcatggatgcgggcattgttgaaaggcagcggattatga

DBGET integrated database retrieval system