KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0145Help
Entry
BLJ_0145          CDS       T01240                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bll00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BLJ_0145 (recR)
DNA repair and recombination proteins [BR:bll03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BLJ_0145 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BLJ_0145 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim Toprim_2 HHH_5 HHH
Motif
Other DBs
NCBI-ProteinID: ADG99638
UniProt: D6ZXJ2
Position
185622..186224
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDAFGRLPGIGPKGAQRIAFYMLSAPEDEARDLAEAIEEVKAKIRFCD
ICGNVCESSPCPVCADPRRDRSVICVVEEPKDVMSIERTREYRGLYHVLGGAINPMANVG
PADLRIPSLLKRLEGDEVKEVIMALDPNIEGEATTSYLTQLLRPVGVKVTRLASGLPVGS
DLEYADEITLGRALAGRREA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgcttatgacggcgcaatacagcgactgatcgacgctttcgggcggctgccc
ggcatcgggccgaagggcgcgcagcgtatcgccttctacatgctgtccgcgcccgaagat
gaagcgcgcgatttggccgaggccatcgaggaggtcaaggccaagatccgcttctgtgat
atttgcggcaacgtgtgcgaatccagcccctgcccggtatgcgccgacccgagacgcgac
cgttcggtgatctgcgtggttgaagagcccaaggacgtgatgagcatcgagcgcacgcgc
gaataccgcggcctataccatgtgctcggcggcgcaatcaacccaatggccaacgttggc
cctgccgacctgcgtattcccagtctgctcaaacgcttagaaggcgatgaggtcaaggaa
gtcattatggcgctcgacccgaatattgaaggcgaggccaccaccagctacttgacccag
ctattgcgacccgtaggtgtcaaggtcacccgacttgccagcggcctgccggtgggctcc
gacttggagtacgccgacgaaatcacgctgggcagggcgctggccggtcggcgtgaggcc
tag

DBGET integrated database retrieval system