KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0590Help
Entry
BLJ_0590          CDS       T01240                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll00260  Glycine, serine and threonine metabolism
bll01100  Metabolic pathways
bll01110  Biosynthesis of secondary metabolites
bll01120  Microbial metabolism in diverse environments
bll01130  Biosynthesis of antibiotics
bll01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bll00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLJ_0590
Enzymes [BR:bll01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BLJ_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADH00065
UniProt: D6ZT59
Position
complement(736807..737832)
Genome map
AA seq 341 aa AA seqDB search
MLSFENDYSRAAHPAVLEAVAEANNHLYSGYGSDELSDQAKAKIREACGQPDADVWFLVG
GTQTNQVVIDTITPAYAGVVAVASGHPNVHEAGAIEFSGHKVLTIPQHNGKMDPTELDEF
CKTFYADGNYEHMVFPGSVYVSQSTEYGTIYSKAELQAIADVAHKYDMPLFADGARLGYA
LTTTGSDMTLADLATIADVFYIGGTKVGALFGEAVVFTKHNTPKHFLTLIKQHGALLAKG
FVLGAQFDALFTDNLYFKIARNANEAADRIREALRAKGYTLTFEAPTNQIFVTMDQPTID
RLEREIKLGFTEKADDTHTVMRICTSWATTPEEVDQLIELL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcttttgagaacgattactcccgcgccgcccatcccgcggtgcttgaagccgtg
gctgaagccaacaaccatctgtattcgggctacgggtccgacgaactgagcgatcaggcc
aaggccaagatccgcgaggcctgcggccagccggacgcggatgtgtggttcctcgtcggc
ggcacgcagaccaaccaggtcgtcatcgacaccatcaccccggcgtatgcaggcgtggtc
gcggtcgcctccggccatccgaacgtgcacgaggccggcgccatcgagttctccgggcac
aaggtgctcacgattccccagcacaacggcaaaatggacccgaccgaactggacgagttc
tgcaagaccttctatgcggacggcaactacgagcacatggtgttcccgggctccgtgtac
gtctcgcaaagcaccgaatatggcaccatctactccaaggccgagttgcaggccatcgcc
gatgtggcgcacaagtacgacatgccgctgttcgcggacggagcgcgactcggctacgcg
ctgaccaccaccggctcagacatgacgctcgcggatctggcgaccatcgccgacgtgttc
tacatcggcggtaccaaggtgggtgccctgttcggcgaggccgtggtgtttaccaagcac
aacacgccgaagcacttcttgaccctcatcaagcagcacggtgccttgctggccaagggc
tttgtgctgggcgcgcagtttgacgctttgttcaccgacaacctgtatttcaagatcgcc
cgcaacgccaatgaggcggccgatcgtattcgcgaggccctgcgcgccaagggctacacg
ctcactttcgaagcgcccaccaaccagattttcgtgacgatggatcagccgaccatcgac
cgtctggagcgcgagatcaagctcggctttaccgaaaaggccgacgacacgcacaccgtg
atgcgcatctgcaccagctgggccaccacgcctgaagaggtcgatcaacttattgagttg
ttgtaa

DBGET integrated database retrieval system