KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0610Help
Entry
BLJ_0610          CDS       T01240                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Brite
KEGG Orthology (KO) [BR:bll00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BLJ_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF1418
Motif
Other DBs
NCBI-ProteinID: ADH00085
UniProt: D6ZT79
Position
757469..758410
Genome map
AA seq 313 aa AA seqDB search
MWVIPMLALVFCLLGGRNDGSPLVAINLKAARRVTAAPFLMLATAVALLPAANSRVGGTI
VAMVSSEGSGGQSPLLLATVLVAASATLLALNGGGVPTSITLALVGASSGAGFAGGQPQW
HLVLRVLGIAILSPLVAFAISRTIYLLFQSRTPQSSTAMVFLGFLLTCIAYGSNDGQKMI
ALFGTAMGVDLGTATHSAAITAIVAATFLTGVLTGMPKGAAALQRGTIVPDSRQIWVTLW
AASAAVLVSSAAGSPVSMTQSISGALIGTCQTNDWRKVRWGEARRILIAWAATLPMAWIL
GYAAANGLDLLPL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtgggttattcccatgttggcattggtgttctgcctgcttggaggaaggaacgacggg
tctcccctggtggccatcaacctcaaggccgcgcgccgcgtcacggcggcccccttcctg
atgctggcgacggcggtggccttgctgccggccgccaacagccgcgtcggaggaaccatc
gtcgccatggtctcctccgaaggatccggcggacaaagtccgctcctgctggcgacggtg
ctcgtcgccgcatcggccaccctgctggcgctcaacggaggcggcgtgcccacctcgatc
acgctcgccctggtcggagcatcctccggagccggcttcgccggcggacagccccaatgg
catctggtgctgcgcgtcctcgggatagcgatactttcgcctctggtggcgttcgccatc
tcccgcactatctacctgctgttccaatccagaaccccgcagtcctcgaccgccatggtc
ttcctcggattcctgctcacctgcatcgcctatggcagcaatgacgggcagaagatgatc
gccctgttcggcaccgccatgggagtcgatttgggaaccgccacgcacagcgccgccatc
accgcaatcgtcgccgcgacgttcctgaccggcgtgctcaccggcatgcccaagggagca
gccgcactgcagcgcggcaccatcgtgccggattcccggcagatctgggtcaccctgtgg
gcggcctccgccgccgtgctcgtcagctcggcggcgggaagcccggtcagcatgacccag
tccatatcgggcgcgctcatcggcacctgccagacgaacgactggcgcaaggtccgctgg
ggcgaggcgcgcaggatcctcatcgcatgggcggcaaccctgcccatggcctggatcctg
ggctatgccgcagccaacgggctcgatctgctgccactgtga

DBGET integrated database retrieval system