KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_1429Help
Entry
BLJ_1429          CDS       T01240                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll00010  Glycolysis / Gluconeogenesis
bll00520  Amino sugar and nucleotide sugar metabolism
bll01100  Metabolic pathways
bll01110  Biosynthesis of secondary metabolites
bll01120  Microbial metabolism in diverse environments
bll01130  Biosynthesis of antibiotics
bll01200  Carbon metabolism
Module
bll_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLJ_1429
   00520 Amino sugar and nucleotide sugar metabolism
    BLJ_1429
Enzymes [BR:bll01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BLJ_1429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADH00873
UniProt: D6ZVG7
Position
complement(1692541..1693308)
Genome map
AA seq 255 aa AA seqDB search
MIETAQAFGVDIGGSGIKAAPVDLTKGDFAEPRLKILTPEVSTPQAVAKIVKQQLDHFEV
PESAPVGIAFPAPIKPGQKLDFMANLDQSWIGVDVTEVFSEACGRPVVVVNDADAAGLAE
VQFGAAKGQDGLVIATTLGTGIGTALIYNGVLIPNTELGHIILSAKHLDAEKYASSAIRE
NEELGYKKWAKRLTKYYGLMEKYFNPDLFTVGGGVSRQSEKFLPYVDIKTPIVPAKLRNQ
AGIVGAAYYASTKQQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaccgcacaggcttttggcgtcgacattggcggttccggcatcaaggccgca
cctgtcgatctgaccaagggcgatttcgccgagccgcgattgaagattctcactcccgag
gtctccacgcctcaggccgtggccaaaatcgtcaagcagcagctcgaccacttcgaagtg
cctgaatccgcacccgttggcatcgccttccccgcgccgatcaagcccggccagaagctc
gacttcatggccaacctcgaccagtcttggattggcgtggacgttactgaagtgttctcc
gaagcctgcggccgcccggtcgtcgtggtgaacgacgccgacgccgccggcctggccgaa
gtccagttcggtgccgccaagggccaggatggtctggtcatcgccaccacactgggcacc
ggcatcggcaccgccttgatctataacggcgtgctcatcccgaacaccgaactcggacac
atcatcctgagcgccaagcatctggacgccgagaagtatgcctcctccgcgattcgcgag
aacgaggaactgggctacaagaagtgggccaagcgtctgaccaagtactacggccttatg
gaaaagtacttcaacccggacctgttcaccgtcggcggcggcgtgagccgtcagagcgaa
aagttcctgccgtacgtggatatcaagaccccgattgtgcccgccaagctgcgtaaccag
gctggcatcgtcggtgccgcctactacgccagcaccaagcagcagtga

DBGET integrated database retrieval system