KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1152Help
Entry
BLLJ_1152         CDS       T01419                                 

Definition
(GenBank) putative phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
blm00010  Glycolysis / Gluconeogenesis
blm00260  Glycine, serine and threonine metabolism
blm00680  Methane metabolism
blm01100  Metabolic pathways
blm01110  Biosynthesis of secondary metabolites
blm01120  Microbial metabolism in diverse environments
blm01130  Biosynthesis of antibiotics
blm01200  Carbon metabolism
blm01230  Biosynthesis of amino acids
Module
blm_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLLJ_1152
  Energy metabolism
   00680 Methane metabolism
    BLLJ_1152
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLLJ_1152
Enzymes [BR:blm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BLLJ_1152
Membrane trafficking [BR:blm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BLLJ_1152
Exosome [BR:blm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BLLJ_1152
  Exosomal proteins of melanoma cells
   BLLJ_1152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Glyco_hydro_108
Motif
Other DBs
NCBI-ProteinID: BAJ66819
UniProt: E8MJ66
Position
complement(1345994..1346839)
Genome map
AA seq 281 aa AA seqDB search
MIDEVMMLRHGRTQYNLEHRLQGQIDVPLDIVGQWQVDQTGFALASRYYWAKVNRLAEHP
EAIAQPGPDAAERTDTRQFEEAPAAGRRMVVMTSDLFRAQQTAHAFADILGLPVTCDQRL
RERSFGEWEGMTRAEIKAVAADDYASWKQHTGGETKHGVESRAAVGQRGADAVRALVIDS
AYSDSTPTTLMLVTHGSWITATISNLLELDPDGMNALGGMRNACWCRLKVRHSVNGTPIE
QPLWELEEYNKAPAIADSADWENGPTDLRGPHMPSWQPIVW
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgaagtgatgatgctgcgtcatggccgtacgcaatacaatctcgaacatcgc
ttgcaaggccagatcgatgtgccgctcgacatcgtaggccaatggcaggttgaccagacc
ggattcgcgctcgcttcacggtattactgggccaaggtgaaccgacttgccgagcatccc
gaagccatcgcccagcccggtcctgacgccgccgaacgcactgatacgcgccagttcgag
gaggctcccgccgctggccggcgcatggtggtgatgacctccgacctgttccgtgcccaa
cagaccgcacacgccttcgccgatattttgggattgccagtcacctgtgaccaacgactg
cgtgaacgcagcttcggcgagtgggaaggcatgacccgcgccgaaatcaaagccgtggca
gccgacgactacgcctcttggaaacagcacactgggggcgaaaccaagcatggtgtggaa
agccgtgccgccgtggggcagcgaggtgccgatgccgtgcgcgcactggtcatcgactcc
gcctattcagacagcacgcccaccacgctgatgctcgtcacccatggctcatggattacc
gccaccatctccaacctgctcgaacttgacccggacggcatgaacgcactcggcggcatg
cgcaacgcctgttggtgccggctcaaagtgcgccacagcgtcaacggcacccccatcgaa
cagcccctgtgggagttggaggaatacaacaaggctcccgccatcgccgacagcgccgac
tgggagaacgggccgaccgatctgcgaggaccgcacatgccaagttggcagccaatcgtc
tggtga

DBGET integrated database retrieval system