KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1745Help
Entry
BLLJ_1745         CDS       T01419                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
blm00330  Arginine and proline metabolism
blm00332  Carbapenem biosynthesis
blm01100  Metabolic pathways
blm01130  Biosynthesis of antibiotics
blm01230  Biosynthesis of amino acids
Module
blm_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BLLJ_1745
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BLLJ_1745
Enzymes [BR:blm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BLLJ_1745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: BAJ67412
UniProt: E8MFD5
Position
complement(2088743..2089876)
Genome map
AA seq 377 aa AA seqDB search
MSTPSQAEVRRMIAAAGTIVVKVGSSSLTQPSGHLDPDKLDALAAALAQVRLMGGRVVLV
SSGAIAAGFGPLGFDSRPVDVATQQATAAVGQGLLMARYETAFGRFGIRVGQILITAEDT
IRATQYRNVERTLDRLLDLGVVPIINENDSLASNEIRFGDNDRLSALVANLVRAEALVLL
TDVDALYTAPPSQPGSRRVEYVPNVIDALGDIQVSGSGSKVGTGGMVTKLEAARVAAVSG
IPTVLTCASNAGPAMMGDPVGTVFAPVKARGSSRRLWIGFAADPRGTIVVDAGAGQAIRG
GRASLLAAGALEVHGDFSAGDPVWIDAESGEHLARGLAGFDSEEIPQMLGRNTAQLKRFL
GPQYAHPLVHRDNLVLV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcactccgagtcaggccgaggtgcggcgcatgatcgccgcagccggaaccattgtc
gtgaaagtcggctccagctcgctgacccagccgagcggtcacctcgacccggacaagctc
gacgcgttggccgcggccttggctcaggtccgattgatgggcggacgtgtggtgctggtc
tcgtccggtgctatcgccgccggtttcgggcctctgggctttgactcgcggccggtggac
gtggccactcagcaggccaccgcagccgtcggccaagggctactgatggcccgctacgag
actgcgttcggtcgattcggtattcgcgtcggccagattctgatcactgccgaagatacg
attcgtgccacccagtaccgcaatgtggaacgcacgctggaccgtctgcttgacctcggc
gtggtgccgatcatcaacgaaaacgattcgttggcctcgaacgagattcgcttcggcgac
aacgatcgactctccgcgttggtggccaacctggtgcgggccgaagccttggtgctactg
accgacgtggacgcgctgtacactgcgccgccctcgcagcccggctcccgccgtgtggaa
tatgtgcccaacgtgattgatgcgctgggcgacatccaagtctccggctccggctccaag
gtcggcaccggcggcatggtcaccaaactcgaggccgcgcgcgtggcggccgtctcgggc
atccccacggtactcacctgcgcctcgaacgcgggccctgcgatgatgggcgatccggtg
ggcaccgtgttcgcaccggttaaggcccgcggctcctcacgccgtctgtggatcggcttc
gccgccgacccgcgcggcacgattgtggtcgatgcgggtgccggccaggcgattcgcggc
gggcgtgcctcgctgctggcggccggcgcgctcgaagtacatggcgatttttccgccggc
gatccggtctggatcgatgccgaaagcggtgaacacctggcccgaggcctcgccggcttc
gattccgaagaaattccgcagatgctcgggcgtaacaccgcccaactcaagcgtttcctc
ggcccccagtacgcccacccactggttcatcgcgacaatctcgtgctcgtgtga

DBGET integrated database retrieval system