KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_0621Help
Entry
Blon_0621         CDS       T00794                                 

Definition
(GenBank) Glucan 1,3-beta-glucosidase
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln00500  Starch and sucrose metabolism
bln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Blon_0621
Enzymes [BR:bln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     Blon_0621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase
Motif
Other DBs
NCBI-ProteinID: ACJ51728
UniProt: B7GPJ8
Position
707797..709002
Genome map
AA seq 401 aa AA seqDB search
MASGALGVGERINGVNLGNWLVLERWMKPGIFAASGEADEIWLHRATKSAELEALLTRHR
DTYITEADFRNIAAHGCNLVRIPVPYFVFGDVPGHPGCTEYLDRAFDWAERAGLKILIDL
HTVPGSQNGFDNGGLTGVVRWHRSLRAVAYALDVLVRLARRYRDHAALFGIEVLNEPIDW
LTYAMSPSSRQAKDRSEARGSGPIPMAFLKRFYRETYHRLRPILAGNQVIVFHDGFRLGR
WRDWFVREGMRGVMLDTHVYMVMAEQFPLFRLIPDRWLMGWYRLFVRWNERRIRRAARYA
PVIVGEWCVANGLVNRVVDKRTGDGGRSKENAMHSASIRGSIYREVAAMQRKAWNVSAGQ
IYWSYQLRGNRDFLPTIDPQSDTSRLDPWDLTHVWHAGWMA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgggcgcgctgggtgttggcgaacgaattaatggggtgaacctcggcaattgg
ctggtgctggagcggtggatgaagccggggatttttgccgccagcggcgaggcggacgag
atctggctgcatcgggctacgaagtcggctgagctggaggctttgctgacgcggcatcgc
gacacgtatattaccgaggccgatttccggaacattgccgcacatggctgcaatctggtg
cgtattccagtgccgtatttcgtgttcggggatgtgcccggtcacccgggctgtaccgag
tatctggacagagcgttcgactgggccgagcgggccgggctcaagattcttatcgacctg
cacacggtgcccggctcgcagaacggattcgataacggcggcctcaccggcgtggtgcgc
tggcatcgtagcctgcgagcggtcgcctatgcgctggatgtgctggtccgtctggctcgc
cggtatcgcgaccacgcggcgctgttcggtatcgaagtgctgaatgagccgattgactgg
ctgacgtatgccatgtcaccatcgagcaggcaggcgaaagaccggtccgaagcgcgagga
agcgggcctattccgatggcgttcctcaagcgtttctaccgcgagacataccaccggttg
cgcccgattctggcagggaatcaagtcatcgtgttccatgacggcttccgactgggccgt
tggcgggactggttcgtgcgcgagggcatgcggggcgtcatgctcgatacgcatgtctat
atggtcatggccgagcaattcccgctgttccgtctgatcccggatcggtggctgatgggc
tggtatcgcttgtttgtgcgctggaacgaacgccgcatccgccgggccgcgcgctatgcg
ccggtgattgtaggggagtggtgcgtggctaatggtctggtaaatcgggtggtcgataag
cgtacaggcgatggtggccgctccaaggaaaacgccatgcacagtgcatctatcagaggc
tctatttaccgcgaggtcgccgccatgcaacgcaaggcatggaacgtgtccgccgggcaa
atctattggagctaccaattacgtggtaatcgtgatttcttgcctaccatcgacccgcaa
tccgacacgtcacgcctcgacccctgggatctcactcacgtttggcacgccggttggatg
gcgtaa

DBGET integrated database retrieval system