KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_0740Help
Entry
Blon_0740         CDS       T00794                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln00230  Purine metabolism
bln01100  Metabolic pathways
Module
bln_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Blon_0740
Enzymes [BR:bln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Blon_0740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 CPT AAA_33
Motif
Other DBs
NCBI-ProteinID: ACJ51844
UniProt: B7GPW4
Position
860465..861055
Genome map
AA seq 196 aa AA seqDB search
MTENTHAGRLIVLTGPTAVGKGTVEAKLRADHPEVWVSVSATTRAPRPGEVDGVNYWFLA
EDEFLAREAAGEFLETAVVHGMAHYGTLLAPVEEHLAAGVPTILEIDLQGARRVKQRAAE
LDLEVVYVFIAPPSFEELERRLIGRGTETAEQQARRLETAKVELAAENEFDVTIVNETVD
QAAADLWSVIAKEYGL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaacacccatgccggccgtctaatcgtcctgactggccccaccgcagtaggt
aaaggcactgtggaggccaagctgcgcgccgaccaccccgaagtgtgggtgtccgtttcc
gccaccacgcgcgctccgcgccccggcgaggttgatggcgtcaactactggttcctcgct
gaagacgagttcctggcccgcgaagcggcgggggagttcctggaaaccgccgtggtgcac
ggcatggcccactacggtacattgctggctccggtggaggagcatctggctgccggcgtg
ccaacaattctggaaatcgatttgcagggcgcccgccgcgtcaagcagcgcgccgccgaa
ctcgacttggaagtggtgtacgtgttcatcgcgccgccgagctttgaagagctcgagcgc
cgtctgatcggccgcggcaccgaaaccgccgaacagcaggcccgtcgcctggaaaccgcc
aaagtggagctcgccgccgaaaacgaattcgacgtcaccatcgtcaacgaaaccgtcgat
caggccgccgccgacctctggtccgtcatcgccaaggaatacgggctgtaa

DBGET integrated database retrieval system