KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1082Help
Entry
Blon_1082         CDS       T00794                                 

Definition
(GenBank) excinuclease ABC, A subunit
  KO
K03701  excinuclease ABC subunit A
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:bln00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    Blon_1082
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bln03400]
    Blon_1082
DNA repair and recombination proteins [BR:bln03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Blon_1082
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      Blon_1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_16 AAA_29 AAA_21 RsgA_GTPase AAA_23 APS_kinase AAA_24 Cytochrom_c3_2 IIGP DnaJ_CXXCXGXG cobW Viral_helicase1 Frankia_peptide
Motif
Other DBs
NCBI-ProteinID: ACJ52172
UniProt: B7GQU2
Position
1264683..1267616
Genome map
AA seq 977 aa AA seqDB search
MTSDSFLSREIKKAPLIEHDGSLVADISHIPNDLKITIQGAREHNLKNVDLAIPRNRMVV
FTGLSGSGKSSLAFDTLFAEGQRRYVESLSAYARQFLGQMDKPDVDFIEGLSPAVSIDQK
TTNRNPRSTVGTITEIYDYLRLLFARTGIPHCPECGEPVASQTPQQIVDTLLGYPERTRF
QILAPVVKGRKGEFVDMIELLRSDGYARALIDGEMTQLSDDIKLTKQKKHTIEVVVDRLV
VKDGIRQRLTDSVETALKLANGSIVIDFVDEEEGSPARRQPFSEHRSCPNGHTLELDEVE
PRTFSFNAPYGACPACTGLGFKLEIDPDLIISDPDKSLADGVIEPWSGTKMTAQYYGHIL
EGLAKEMGFSMKTPWKDLPDDVKHDILYGHDFKVNVSYRNRWGRLREYSTGFEGVIRTLM
RRHDETDSQSMREYYESYMREVPCQVCHGRRLKPEVLAVTVDGKSIFDVCDMPVVRELAW
INGLKLEGSAQLIAGEVLKEIKARLGFLNDVGLDYLTLSRAAATLSGGEAQRIRLATQIG
SGLVGVMYVLDEPSIGLHQRDNERLIETLHHLRDLGNTLIVVEHDEDTIRRADWVVDIGP
GAGEHGGEVIYSGPAKHLIEAKRSITGDYIAHRREIAVPAKRRKIHKTQVLKVVGVRENN
LKNIDVSFPLGVLTVVTGVSGSGKSSLVNTILYPVLADKLNGARIVPGRHRRVEGVDQVR
KVIHVDQNPIGRTPRSNPATYTGVWDKIRTLFAKTPEAQVRGYGPGRFSFNVKGGRCEAC
HGDGTLKIEMNFLPDVYVDCEVCHGKRYNRETLEVTYNGKTVADILNMPIEEAADFFKAY
TGISRYLKTLVDVGLGYIRLGQPAPTLSGGESQRVKLATELQRRSDGKTVYILDEPTTGL
HFEDVNKLLKVLQSLVDKGNTVIVIEHNLDVIKEADWLIDLGPEGGDGGGTIVTQGTPEQ
VAECESSWTGKFLKPML
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgactccttcctgagccgggagatcaaaaaggcgccgctgatcgaacacgat
ggttcgctggtagctgatatctcgcacatcccgaacgatctcaagatcacgattcagggt
gcgcgcgaacacaacctcaagaatgtcgatctggcgattccacgcaaccgtatggtcgtg
ttcaccggcctgtccggttccggcaaatcctcgctcgcgtttgacaccctgttcgccgaa
ggccagcgacgctacgtcgaatccctgtccgcctacgcccgccagttcctgggtcagatg
gacaagcccgacgttgacttcatcgagggcctgagcccggccgtctccatcgaccagaag
accaccaaccgcaacccgcgttctaccgtcggcaccatcaccgaaatctacgattacctg
cgactgctcttcgcccgcaccggcatcccgcactgccccgaatgcggcgagcccgtcgcc
tcccagaccccgcagcagatcgtcgacacactgctcggctatccggagcgcacgcgattc
cagattctcgcgcccgtggtcaagggccgcaagggcgagttcgtggacatgatcgagctg
ctgcgctccgacggctacgcccgcgcgctcatcgacggcgagatgacgcagctgtccgac
gacatcaaactcaccaagcagaagaagcacaccatcgaggtcgtggtcgaccgactcgtg
gtcaaggacggtatccgccaacgtttgactgattcggtggaaaccgccctcaagctcgcc
aacggcagcatcgtcatcgacttcgtggacgaggaggaaggcagcccggcccgccgccag
ccgttctccgaacaccgcagctgcccgaacgggcacacgctcgaactcgacgaggtcgag
ccgcgcaccttctccttcaacgccccctacggcgcctgccccgcctgcaccggtctcggc
ttcaaactggaaatcgacccggacctcatcatctccgacccggacaagtcactggccgac
ggcgtcatcgaaccgtggagcggcaccaagatgaccgcccagtactacggccacatcctc
gaaggtctggccaaggaaatgggcttctccatgaagactccctggaaggacctgccggac
gacgtcaagcacgacatcctctacggccacgacttcaaggtcaacgtctcctaccgcaat
cgctggggacgcctgcgcgaatactccaccggcttcgaaggcgtgatccgcacgctcatg
cgccgccacgacgaaaccgattcgcagtccatgcgcgaatactacgagtcgtacatgcgc
gaagtgccctgccaggtctgccacggacgccgtctgaagcccgaagtgctcgctgtcact
gtggacggcaaatccatcttcgacgtgtgtgacatgcccgtcgtacgcgaactcgcctgg
atcaacggcctgaaactcgaaggctcggcacagctgatcgccggcgaagtgctcaaggag
atcaaggcccgactcggcttcctgaacgacgtcggcctcgactacctgaccctctcgcgc
gcggccgccaccctgtccggcggcgaggcgcagcgcatccgactcgccacgcagatcggc
tccggtctggtcggcgtcatgtacgtgctcgacgagccgtccatcggcctgcaccagcgt
gacaacgaacgcctcatcgaaaccctgcaccacctgcgcgatctcggcaacacgctgatt
gtcgtcgaacacgacgaggacacgatacgccgtgccgactgggtggtcgacatcggcccc
ggagccggcgaacacggcggcgaagtcatctactccggccccgccaagcacctcatagaa
gccaagcgctccatcaccggcgactacatcgcccaccggcgagagattgccgtgcccgcc
aagcgccgcaagatccacaagacccaggtgctcaaagtcgtgggtgtccgcgagaacaac
ctcaagaacatcgacgtgagcttcccgctcggcgtgctcaccgtggtcaccggcgtctcc
ggctccggcaaatcctcgctggtcaacacgatcctctacccggtgctcgccgacaagctc
aacggtgcacgcatcgtacccggccgccacaggcgcgtggaaggcgtggaccaggtgcgc
aaggtgatccacgtcgaccagaacccgatcggccgcacgccgcgatccaaccccgccacc
tacaccggtgtgtgggacaagatccgcaccctgttcgccaagactcccgaagcccaggtg
cgcggctacggccccggccgcttcagtttcaacgtcaaaggcggccgatgtgaggcctgc
cacggtgatggcacgctgaagatcgaaatgaacttcctgcccgacgtctacgtggactgc
gaggtctgccacggcaaacgatacaaccgcgagactctcgaagtcacgtacaacggcaag
accgtggccgacatcctcaacatgcccatcgaggaggccgccgacttcttcaaggcgtac
accggcatctcccgatacctgaagaccctcgtggacgtcggcctcggctacatccgactc
ggccagcccgcacccaccctgtccggcggcgaatcgcagcgcgtcaagcttgccaccgag
ctgcagcgccgatccgacggcaaaaccgtgtacatcctcgacgagccgaccaccggcctg
cacttcgaagacgtgaacaagctgctcaaggtgctgcagtccctggtggacaagggcaat
acggtcatcgtcatcgaacataatctggatgtgatcaaggaggccgactggctgatcgat
ctcggtccggagggcggcgacggaggcggcaccatcgtcacgcagggcacgcccgaacag
gttgccgaatgcgaatcctcatggaccggcaagttcctgaagcccatgctttag

DBGET integrated database retrieval system