KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1084Help
Entry
Blon_1084         CDS       T00794                                 

Definition
(GenBank) Shikimate dehydrogenase substrate binding, N-terminal domain protein
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bln01100  Metabolic pathways
bln01110  Biosynthesis of secondary metabolites
bln01130  Biosynthesis of antibiotics
bln01230  Biosynthesis of amino acids
Module
bln_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Blon_1084
Enzymes [BR:bln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     Blon_1084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_dh_N
Motif
Other DBs
NCBI-ProteinID: ACJ52174
UniProt: B7GQU4
Position
1270242..1271213
Genome map
AA seq 323 aa AA seqDB search
MANHRCAVLGKPVAHSLSPVLHNAAYRSLKLDDWLYDKHEVGEDDLDAFLKGLDSTWAGL
SLTMPLKKAIQPYGVPENLWAKELKVANTAVFDWSVATDDPAWPNGKPDIKLYNTDVIGI
QLAFDHANRELGEHHTASRSGAALIIGNGNTATSALAACCMMPEIGHIIVAARHPGKNTG
LKPVAEKFVNVHNPYSEIELGDDQALLEAARNATYVINTIPGHAADNVADALTNAGTEPF
SGLLLDVVYDPRPTKLMEAWRAHGGHAIGGEEMLLYQALVQVLLMTGIWDDDPPSDADQR
LQDTTTEDDQLEIAMRKALEEAL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggccaatcatcgttgcgctgtactcggcaaacccgtcgcgcactcattgtcacccgtg
ctccacaacgcggcctaccgttcgctgaaactcgacgattggctgtacgacaagcacgaa
gtgggagaggatgacctcgacgctttcctcaaaggcctcgactcgacgtgggctggcctg
agcctgaccatgccgttgaaaaaggccatccaaccgtacggtgttccggaaaatctgtgg
gccaaggaactgaaggtggcgaataccgcggtattcgactggagcgtggctaccgatgat
cccgcttggccgaacggcaagccagacatcaagctatacaacaccgatgtcatcggcatc
caactcgccttcgaccatgccaatcgcgaactcggcgaacaccacaccgcatcgagaagc
ggcgccgcgctgatcatcggcaatggcaacaccgccacttcggcgttagccgcatgctgc
atgatgcccgaaatcggccatatcatcgtcgccgcccgccaccccggaaaaaacaccggg
cttaaaccagtggccgagaagttcgtcaacgtgcataacccgtatagcgaaatcgaatta
ggcgacgatcaggccctgctcgaggcagcccgcaacgccacctatgtcatcaacacgatt
cccggacatgcggccgacaacgtcgcggatgccctcaccaatgccggaaccgagccattc
tccggactgctgctggacgtggtctacgatccacgccccaccaagctcatggaagcctgg
cgcgctcatggcggtcacgccatcggcggtgaagaaatgctgctgtaccaagctctcgta
caggtattgctgatgaccggtatctgggatgacgacccgcccagcgatgccgaccagcgt
ctgcaggacaccaccaccgaagacgaccagctggagatcgcgatgcgcaaagctcttgag
gaggcgttgtaa

DBGET integrated database retrieval system