KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1085Help
Entry
Blon_1085         CDS       T00794                                 

Definition
(GenBank) Uncharacterised P-loop ATPase protein UPF0042
  KO
K06958  RNase adapter protein RapZ
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Brite
Messenger RNA biogenesis [BR:bln03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     Blon_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_2 TGF_beta_GS
Motif
Other DBs
NCBI-ProteinID: ACJ52175
UniProt: B7GQU5
Position
1271213..1272199
Genome map
AA seq 328 aa AA seqDB search
MSQQTTIRDTGEAAATNAPANSATSTSTPDNQPTPLDAFEVLLITGMSGAGRSHAADCVE
DMGWYVVDNLPPKLLIPLVDMMTTSGSGSGSGVHKLAAVIDVRSSYFDELAAVLGHLDDL
GVKTHILFLDASNEVLIKRYESVRRPHPLQHGNRLIDGILEERHLLEDLKERADWVIDTS
SLSIHQLSTKLYETMLGSGPTTVAVHIFSFGFKYGMPIDADFVADVRFLPNPFWVPNLRE
LTGHDKPVADYVLSSKGAKEFLDAYEKAIEIALEGYAQEDKHYVTIAVGCTGGQHRSVAM
SEELARRLRAHGLNVTVSAREQHKRHSS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacagacaacaatccgcgataccggcgaggcggccgccacgaatgcgccggcg
aattccgcgacatccacatcgactccggacaaccagccgaccccgcttgatgccttcgaa
gtgctgctcatcaccggtatgtccggcgcaggccgctctcatgccgctgactgcgtggaa
gacatgggatggtatgtggtcgacaacctgcctcccaaactgcttatcccgcttgtcgac
atgatgaccacctccggttccggatcggggtcgggcgtccacaagcttgccgccgtcatc
gacgtgcgctccagctatttcgacgagctggccgccgtgctcggccatctggatgatctc
ggcgtcaaaacccatattctgttcctcgacgccagcaacgaagtgctcatcaagcgctat
gaatccgtgcgccgcccgcacccgctgcagcacggcaaccgactgatcgacggcatcctt
gaggaacgtcacctgctggaagacctcaaggagcgagccgactgggtcatcgacaccagc
tccctgagcatccaccagctgtccaccaaactctacgagacgatgctcggttcaggcccc
accaccgtggcggtacacatcttcagcttcggcttcaaatacggcatgcccatcgacgcc
gatttcgtggccgacgtgcgttttctgcccaacccgttctgggtgcccaacctgcgcgag
cttaccgggcacgacaagccggtcgccgactacgtgctttccagcaagggtgccaaggaa
tttctcgacgcttatgagaaagctatcgagattgcgttggaaggatacgcccaggaagac
aagcactacgtaaccatcgccgtcggctgcaccggtggccagcaccggtcggtggcgatg
agcgaggagctggctcgccgcttacgcgcacatgggctcaacgtaaccgtttccgcgaga
gaacagcacaagcgtcactcatcgtaa

DBGET integrated database retrieval system