KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1087Help
Entry
Blon_1087         CDS       T00794                                 

Definition
(GenBank) Phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln00010  Glycolysis / Gluconeogenesis
bln01100  Metabolic pathways
bln01110  Biosynthesis of secondary metabolites
bln01120  Microbial metabolism in diverse environments
bln01130  Biosynthesis of antibiotics
bln01200  Carbon metabolism
bln01230  Biosynthesis of amino acids
Module
bln_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Blon_1087
Enzymes [BR:bln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Blon_1087
Exosome [BR:bln04147]
 Exosomal proteins
  Proteins found in most exosomes
   Blon_1087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK
Motif
Other DBs
NCBI-ProteinID: ACJ52177
UniProt: B7GQU7
Position
1273517..1274722
Genome map
AA seq 401 aa AA seqDB search
MKTLKDLGDLKGKRVLVRADFNVPLDGTTITDDGRIKAALPTIKTLREEGAKVILMAHLG
RPKGKVVPELSLAPVAARLGELLGTNVPLAKDTYGEDAQAKVAAMNDGDVVLLENVRFNP
EETSKDADERAAYAKKIAALGEAFVSDGFGVVHRAQGSNYDVAADLPAAAGLLVEKEVKA
LSKATENPERPFTVVLGGSKVSDKLGVIENLLDKANRLVIGGGMVFTFLKAKGYEVGTSL
LEEDQLEKVKGYIETAEKNGVELVLPTDVVVNAGFPAGDTPVAPEVVAADAIPADKMGLD
IGPESQKLFHDKIVDSKTVVWNGPMGVFEVPEFAAGTKAVAQGLVDATAAGAFTIVGGGD
SASAVRNLGFPEDGFSHISTGGGASLEFLEGKELPGLKVLE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaagacactcaaggaccttggagatctcaagggcaagcgcgttctggttcgcgctgat
tttaatgttccgctggacggcaccaccatcaccgatgacggtcgaatcaaggctgctctg
ccgaccatcaagaccctgcgcgaagaaggcgccaaggtcatcctcatggcccaccttggc
cgcccgaagggcaaggtcgttcctgagctgagcctggccccggttgccgcccgcctcggc
gagctgctcggcaccaacgtgccgctggccaaggacacctacggcgaggacgctcaggcc
aaggtcgccgccatgaacgatggcgacgttgtgctgcttgagaacgttcgtttcaacccg
gaggagacctccaaggacgccgacgaacgcgccgcttacgccaagaagatcgccgccctc
ggcgaggccttcgtttccgatggcttcggcgtggtccaccgcgcccagggctccaactac
gacgttgccgccgatctgccggccgccgcaggcctgctggtcgagaaggaagtcaaggcc
ctgtccaaggccaccgagaacccggagcgtccgttcaccgtggtgctcggcggttccaag
gtctccgacaagctcggcgtcatcgagaacctgctcgacaaggccaaccgtctggtcatc
ggcggcggcatggtgttcaccttcctcaaggccaagggctacgaggtcggcacctccctg
cttgaagaggaccagcttgagaaggtcaagggctacatcgagaccgccgagaagaacggc
gttgagctcgtgctgccgaccgacgtcgtcgtgaacgccggcttcccggccggtgacacc
ccggttgctcctgaagtcgttgccgccgacgccatcccggccgacaagatgggtctggac
atcggcccggagtcccagaagctcttccacgacaagatcgtcgactccaagaccgtcgtg
tggaacggcccgatgggcgtgttcgaggttcctgagttcgccgccggcaccaaggccgtg
gcccagggtctggtcgacgccaccgcagccggtgcgttcaccatcgtcggtggcggcgac
tccgcctccgccgtgcgcaacctcggcttcccggaggacggcttctcccacatctccacc
ggtggtggcgcttccctcgagttcctcgaaggcaaggagctccctggcctgaaggtgctt
gagtaa

DBGET integrated database retrieval system