KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1088Help
Entry
Blon_1088         CDS       T00794                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln00010  Glycolysis / Gluconeogenesis
bln00051  Fructose and mannose metabolism
bln00562  Inositol phosphate metabolism
bln01100  Metabolic pathways
bln01110  Biosynthesis of secondary metabolites
bln01120  Microbial metabolism in diverse environments
bln01130  Biosynthesis of antibiotics
bln01200  Carbon metabolism
bln01230  Biosynthesis of amino acids
Module
bln_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Blon_1088
   00051 Fructose and mannose metabolism
    Blon_1088
   00562 Inositol phosphate metabolism
    Blon_1088
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bln04147]
    Blon_1088
Enzymes [BR:bln01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Blon_1088
Exosome [BR:bln04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Blon_1088
  Exosomal proteins of bladder cancer cells
   Blon_1088
  Exosomal proteins of melanoma cells
   Blon_1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM AAA_26
Motif
Other DBs
NCBI-ProteinID: ACJ52178
UniProt: B7GQU8
Position
1274780..1275583
Genome map
AA seq 267 aa AA seqDB search
MASKRIPLVAGNWKMNFDHLEATYFVQKLVWLLRDAHFDFKRCEVALFPSFTSLRSVQVL
VEADKLHVAYGAQSVSVTTQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDANIVD
QVRAVFAAGMQPILCVGESFEERRQGIELDFAVGQVRDVTRDLNEEQAAELIVAYEPVWA
IGTGMVATPQSAQDAANAIRNDLKTTFGTKVSDSVHILYGGSVTSKNAAELISQPDVDGF
LIGGAALDVEELAKIARLALKSMKSRN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaacgcattccgttggtggccggcaactggaagatgaatttcgaccatctt
gaagccacttacttcgtgcagaagctggtatggctgttgcgtgacgctcacttcgacttc
aaacgctgcgaagtcgcgcttttcccctcgttcacgtcattgcgcagcgtacaggtgctg
gtcgaagccgacaagctccatgtcgcctacggcgcacaatccgtttccgtgaccacccaa
ggtgccttcaccggcgatgtgtccgcggacatgatcgcccatctcggctgctcatacgtc
atcgtcggccactccgaacgccgcaaataccatcctgaagatgacgccaatatcgtcgat
caggtacgtgccgtgttcgccgccggcatgcagccgattttgtgcgtcggcgaaagcttc
gaggaacgacgtcaaggcattgaactcgatttcgccgtgggccaggtacgagacgtcacc
cgcgatctcaacgaagaacaagccgccgaactcatcgtggcctacgaacctgtctgggcc
attggcaccggcatggtggccactccgcaatccgcccaggatgccgcaaacgccatccgc
aacgatttgaagaccacctttggcacgaaggtatccgatagcgtacatatcctgtacggc
ggatcggtcacctcgaaaaatgcggcggaactcatttcccagcccgacgttgacggcttc
ctgatcggaggggcggccttggacgttgaggaactcgccaaaatcgctcgattggcactt
aaatccatgaaatcacggaactaa

DBGET integrated database retrieval system