KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1091Help
Entry
Blon_1091         CDS       T00794                                 

Definition
(GenBank) Haloacid dehalogenase domain protein hydrolase, type 3
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ACJ52181
UniProt: B7GQV1
Position
1276944..1277795
Genome map
AA seq 283 aa AA seqDB search
MILDAITPKQPRLLVADLDGTLLHDAEVFEDRFITQRSIDTINRAHDAGLKFAIATARPV
STGLQFAEKLPVDAVIYLNGALIDFDPAHSDFDLLTSGATPADENHLIKIGFSSRRACEV
CLFLLDRMPGLKLGIVMNDVRYTNFDVRVYWKTQAFQYTNFHDVPEGVADKITIFPEPEQ
WNELRALIPPDFDISISEGVMWMLMNPQANKEHALRLLCERMDVPLEQTAAFGDDLIDIN
MMSESGRGVAVANANPKVLSIADEICPSNNEDGVAQWIEAQLG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgattctcgacgccatcacaccgaaacaaccccgactgctggtcgccgacctcgacggc
acgttgctgcacgacgccgaggtattcgaggaccggttcatcacccagcgcagcatcgac
accatcaaccgcgcgcacgatgccggactgaaattcgccatcgccaccgcgcggccggtg
agtaccggcctccagttcgccgaaaaactgccggtggacgccgtaatctatctgaacggc
gccctcatcgatttcgacccggcccactccgacttcgacctgctcacctcaggtgccacg
ccggccgatgagaaccatttgatcaagattggcttctcctcacggcgtgcctgcgaagtc
tgtctgttcctgctcgatcgcatgcccggcctgaagctcggcatcgtgatgaacgacgtg
cgctacaccaacttcgatgtgcgcgtgtattggaaaactcaggccttccaatacacgaac
ttccacgacgtgcccgaaggcgtggcggacaagatcaccatcttccccgagcctgaacag
tggaacgagctgcgtgcgctgattccgccggacttcgacatctccatcagcgaaggcgtg
atgtggatgctcatgaacccgcaggccaacaaggagcacgcgctgcgtctgctatgcgaa
cggatggatgtgccgctcgaacagaccgccgccttcggcgacgacctcatcgatatcaac
atgatgagcgaatccggccggggtgtggccgtggccaacgcgaaccccaaggtgttgtcc
atcgccgacgagatctgcccgtccaacaacgaggacggcgtcgcccaatggattgaagcg
cagttgggctga

DBGET integrated database retrieval system