KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1092Help
Entry
Blon_1092         CDS       T00794                                 

Definition
(GenBank) aminotransferase, class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln00220  Arginine biosynthesis
bln00250  Alanine, aspartate and glutamate metabolism
bln00290  Valine, leucine and isoleucine biosynthesis
bln01100  Metabolic pathways
bln01110  Biosynthesis of secondary metabolites
bln01130  Biosynthesis of antibiotics
bln01210  2-Oxocarboxylic acid metabolism
bln01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bln00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Blon_1092
   00290 Valine, leucine and isoleucine biosynthesis
    Blon_1092
   00220 Arginine biosynthesis
    Blon_1092
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bln01007]
    Blon_1092
Enzymes [BR:bln01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Blon_1092
    2.6.1.66  valine---pyruvate transaminase
     Blon_1092
Amino acid related enzymes [BR:bln01007]
 Aminotransferase (transaminase)
  Class I
   Blon_1092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 HTH_3 HTH_19
Motif
Other DBs
NCBI-ProteinID: ACJ52182
UniProt: B7GQV2
Position
1277945..1279420
Genome map
AA seq 491 aa AA seqDB search
MNSRGLKQVDLVHAAEHRGVKMGKSHISQYVAGKTMPREDVLEFLASELDVDANWLRGEE
SSAPSNGDAAPEGAGPRTDDGTAPARRRTFGKSHKLDNVLYDVRGPVADEAMRMEANGTH
ILKLNIGNPAPFGFRTPDEVVYDMAHQLTDTEGYSPSKGLFSARKAIMQYAQLKNIPNVT
IDDIYTGNGVSELINLSMSALLDTGDEVLVPSPDYPLWTACVNLAGGTAVHYLCDEQSEW
YPDIDDIRSKITSNTKAIVIINPNNPTGALYPKEVLQQIVDIARERRLIIFSDEIYDRLV
MDGLQHVSIASMAPDLFCVTFSGLSKSHMIAGYRIGWMILSGNKRIAKDYIEGLNMLANM
RMCSNVPAQSVVQTALGGHQSVKDYLVPGGRVYDQRDLVYDMLNAIPGISAVKPKAAFYI
FPKIDVKRFNIHSDEQFALDLLHEKHILISHGGAFNWRHPDHFRVVYLPRIGMLHETMEE
LADFFSYYRQN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaggggactgaagcaggtcgatttggtgcacgccgccgaacatcgtggcgta
aagatgggcaagagccacatcagccaatacgtggccggcaagaccatgccccgcgaggac
gtgctcgaattcctggccagcgaactggacgtcgacgcgaactggctgcgcggcgaggaa
tcatccgctccctccaatggcgacgcggcaccggagggagccgggccgcggacggacgat
gggaccgcgccggcgcgccggcgtaccttcggcaaatcgcacaagcttgacaacgtgctc
tacgacgtgcgcggcccggtcgccgacgaggcgatgcgcatggaggccaacggcacccac
atcctgaaattgaacatcggcaatccggcacccttcggcttccgcacgccggacgaagtc
gtctacgacatggcccaccagctcaccgacaccgaaggctactcgccgtccaagggcctg
ttctccgcgcgcaaggccatcatgcagtacgcgcagctgaagaacatcccgaacgtcacc
atcgacgacatctacaccggcaacggcgtcagcgagctcatcaacctgtccatgtccgcg
ctgctcgacaccggcgacgaagtgctcgtgccctccccggactacccgctgtggaccgcc
tgcgtgaacctggccggcggcaccgccgtgcactacctgtgcgacgaacagtccgaatgg
tatccggacatcgacgacatccgctccaagatcaccagcaacaccaaggcgattgtcatc
atcaacccgaacaaccccaccggcgcactttacccaaaggaagtgctccagcagatcgtc
gacatcgcgcgcgaacgccggctcatcatcttctccgacgagatctacgaccgtctcgtc
atggacggcctgcagcacgtctccatcgcctcgatggccccggacctgttctgcgtgacc
ttctccggcctgtcgaaatcgcacatgatcgccggctaccgcatcggctggatgattttg
tccggcaacaagcgcatcgccaaggattacatcgaaggcctcaacatgctcgccaacatg
cgcatgtgctcgaacgtgcccgcccagtccgtggtgcagaccgcgctcggcggacaccag
agcgtcaaggactatctcgttcccggcggccgcgtgtatgaccagcgcgatctcgtctac
gacatgctcaacgccatccctggcatcagcgccgttaagcccaaggccgcgttctacatc
ttcccgaagatcgacgtcaagcggttcaacattcactcggatgagcagttcgcgctcgat
ctgctgcatgaaaagcacatcctcatcagccatggcggtgcgttcaactggcggcatccc
gaccacttccgtgtggtgtacctgccgcgcataggcatgctgcacgaaaccatggaggag
ctcgccgacttcttcagctactaccggcagaactga

DBGET integrated database retrieval system