KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1093Help
Entry
Blon_1093         CDS       T00794                                 

Definition
(GenBank) MATE efflux family protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MatE Polysacc_synt_C
Motif
Other DBs
NCBI-ProteinID: ACJ52183
UniProt: B7GQV3
Position
1279424..1280782
Genome map
AA seq 452 aa AA seqDB search
MAHTDALDSGLGVTPVPRLALTMSFPAIVAQAANASYTIIDRMFIGHIPEVGNAAMTGVG
ICFPILLAVTAFASLIGAGGAPRASIELGRGNFKKAERILGTSTAFLVVIALTLTAVLQS
VKRPILYAFGASDATIAYATDFITIYLIGTVFVQLTLGLNSFISAQGKTTVAMVSVLIGT
GASMVLDPVFIFVFGWGVRGAAAANVIAQLISTVWIVLFLSSGRSAIRLRPANIRIDRII
IPVLTLGLAPFIMQITECLINVVFNVGLQRYGGDDYVTSITIITSLIQVVGVLTGGFQQG
IQPIIGFNFGARNMRRVRQAIRMAFVTQIASATALVSVLAAFPGFFASWFTTEQTVIDIV
TRMMPIFVCGWGVFGIQLGAQCAFVGMGQAGQSVFLAVFRKVILLVPLALLLPHWLGVDG
IFIAEPISDATSGMVAGLLFLITYRRIRRNLV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatacagacgcacttgattcagggctgggcgtcacgccggtgccccgtctggcc
ctcaccatgtcgttccccgccatcgtggcgcaggcggcgaacgcctcgtacacgatcatc
gaccggatgttcatagggcatatccccgaagtcggcaatgcggcgatgacgggagtcggc
atctgtttcccgattctgttggccgtcaccgccttcgcctcgctgatcggcgccggcggc
gcgccgcgcgcctccattgaactcggtcgcggcaacttcaagaaggccgagcgtatcctc
ggtaccagcacggcgttcctcgtcgtcatagccctgaccctcaccgcggtgctgcagtcg
gtgaaacggccgattctctatgccttcggcgctagcgacgcgaccatcgcctatgcgacc
gatttcatcaccatctacctgatcggcaccgttttcgtgcagttgacgctcgggctgaac
agcttcatctcggcgcagggcaagaccacggtggccatggtctcggtgctcatcggcacc
ggtgcgtccatggttctcgatcccgtgttcattttcgttttcggatggggcgtcagggga
gcggccgccgcgaatgtgatcgcacaactgatttcgacggtatggatcgtgctgttcctt
tcctcggggcgcagcgccattcgtctgcgcccggcgaacatccgaatcgaccgaatcatc
attcccgtgttgacgcttggtctggcgcccttcatcatgcagattacggaatgtctgatc
aatgtggtgttcaatgtcggtctgcagcggtacggcggtgatgattacgtcacctcgatc
accatcatcacgtcgctgatacaggtcgtgggcgtactgaccggcggttttcagcagggc
atccagccgatcatagggttcaatttcggcgcccgcaatatgcggcgcgtccggcaggcg
attcgcatggccttcgtcacgcagatcgcctccgccacggcgttggtgtcggtgcttgcc
gcattcccgggattcttcgcatcatggttcaccacggaacagacggtcatcgacatcgtg
acccgcatgatgccgatcttcgtatgcggctggggcgtcttcggcatccagctgggcgcg
caatgcgcattcgtcggcatggggcaggccggacagtcggtgttcctggccgtcttccgc
aaggtcatcctgcttgtaccgctcgcattgctactgccgcattggctcggcgtcgatggc
atcttcatcgccgaacccatctccgacgccacctcgggcatggtggccggtctgctgttc
ctcatcacctaccgcaggatccgacggaatctggtctag

DBGET integrated database retrieval system