KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1094Help
Entry
Blon_1094         CDS       T00794                                 

Definition
(GenBank) branched-chain amino acid transport system II carrier protein
  KO
K03311  branched-chain amino acid:cation transporter, LIVCS family
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Brite
KEGG Orthology (KO) [BR:bln00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Blon_1094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Branch_AA_trans
Motif
Other DBs
NCBI-ProteinID: ACJ52184
UniProt: B7GQV4
Position
complement(1280779..1282137)
Genome map
AA seq 452 aa AA seqDB search
MNKLVAHQRLVMTFTFFSMFFGAGNLIFPPFVGAQAGSATMPAAVGFIVSAVGLPILGVL
AVTFAGGFDGLARRVSPGFALFLGVAIMLTIGPCFAIPRTATTSFEMMVSPFVPASYGWL
AQLIYSCVFFALAFLLAQHPEKLSKVLGRFMGPLLLVLIAILFVACLVHGIGTPAKPMGD
YFANQVTRGFLDGYQTMDLLAALYFGIVISANIRAQHIDDEIQVQKETAYAGLGTGVLLI
VIYGALSYVGAVSGAISAIDPAKDTGATVLTNLTSSLFGTFGTAFLGIVFVIACLNVCTG
LICTCATYFHARFRSIAGRTPSYRTWQVIFTVFSFIVSNAGLSAIIKVSVPVLSALYPIA
IVLVLLALTHTMLGARFPRVYFWTVLLVAVTSFATCVSSLAVVFGGDIAWLDAALAALPL
QQYQLGWILPAVIGVIAGIVDKRRVTPAGRDI
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcttgtcgcgcaccaacggttggtgatgacatttaccttcttttcgatgttc
ttcggggcgggcaacctgatcttccctccattcgttggcgcgcaggccggatcggcgacc
atgccggcagccgtcggcttcatcgtctccgcggtcggattgccgattctcggcgtcctc
gcggtcaccttcgcagggggattcgatgggctcgcccgacgggtctcccccggattcgcc
ctgtttcttggtgtggcgatcatgcttaccatcggcccctgctttgcgattccgcgcacg
gccaccacgtcattcgagatgatggtgtcgcctttcgtgccggcttcctacggctggctc
gcgcaactcatctactcgtgcgtgttcttcgcattggccttcctgctcgcccagcatccc
gagaaactctccaaggtgcttggacgtttcatgggaccgctgctgctggtgctgatcgcc
atcctgttcgtcgcatgcctggtacacggcatcggcacgccggccaaaccgatgggcgac
tacttcgccaatcaggtgacgcgaggcttcctcgacggctaccagaccatggatctgctc
gccgcgctgtacttcggcatcgtgatctccgcgaacatccgcgcccagcacatcgatgac
gagatccaagtgcagaaggagaccgcatacgccggtcttggcaccggcgttctgctcatc
gtgatctatggagcgctgagctatgtgggagcggtatccggcgccatcagcgccatcgac
ccggcaaaggacacgggcgcgaccgtgctcaccaacctcacctcgtccctgttcggcacc
ttcggcaccgcgttcctcggtatcgtgttcgtcatagcctgcctcaacgtgtgcaccgga
ctgatctgcacctgcgccacctatttccacgccagattccgctccatcgcgggacgaacg
ccgagctaccgcacgtggcaggtcatcttcaccgtgttcagcttcatcgtctccaacgcc
ggactgagcgcgatcatcaaggtctccgtgccggtactgtccgcattgtatccgatcgcc
atcgtactggtgctgctcgcgctcacccataccatgctcggcgcgcggttcccgcgcgtc
tatttctggaccgtgctgctggtggccgtcacctccttcgccacctgtgtctccagcttg
gccgtcgtgttcggcggcgacatcgcctggctggatgccgcgctggccgcactgcccttg
cagcagtaccagctcggctggatcctacccgccgtcatcggcgtcattgccggcatcgtc
gacaagcggcgcgtcacgcctgccggccgcgacatctag

DBGET integrated database retrieval system