KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1096Help
Entry
Blon_1096         CDS       T00794                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln00030  Pentose phosphate pathway
bln01100  Metabolic pathways
bln01110  Biosynthesis of secondary metabolites
bln01120  Microbial metabolism in diverse environments
bln01130  Biosynthesis of antibiotics
bln01200  Carbon metabolism
bln01230  Biosynthesis of amino acids
Module
bln_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bln_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Blon_1096
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Blon_1096
Enzymes [BR:bln01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Blon_1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C XFP_C DUF2586
Motif
Other DBs
NCBI-ProteinID: ACJ52186
UniProt: B7GQV6
Position
complement(1283617..1285725)
Genome map
AA seq 702 aa AA seqDB search
MTEFKETELDERAIKMAKVLSADAVEKAGSGHPGSPVSLAPVAYTLYQHFIKHDPNDPNW
EGRDRFILSGGHASLTQYVQLYFSGYGVTLDDLKSFRGSAATRTPGHPEYGLTPGIEMTT
GPLGQGLASAIGFAYGERFQRGLLDPETPKEDSPFYHKIWAICGEGDIEEGISGEAASLA
ANQKLGNLTVIFDANRIQIEGDTNLVLAEDVLKRFQAYGWYTDEFSFIQPDGSYKEDIEG
LADVIAKAEKAAPDQPKLIKVHSLIAWPTPGKTNDPSSHGSKLGAEAVAGLKKLLGYDPE
ESFHVDEEALAHARKVADRGLEAHKAWDEKFDAWRKANPDKAALYDRLKAGELPEGFDKA
LDDLEATFEVGKNVATRGASGSVLNAIAAVMPELWGGSADLGGSNKTDLKGAATFAPAEC
ATVQWPNCNEFGRQLHFGVREFAMGCITNGILLGSHTRPFGGTFFMFSDYERSAVRLAAL
MQIPNLYIWSHDSVAVGEDGPTHQPVEHLASFRAIPQLEVIRPADAFETAEAYRYFFEKK
NTLPGAMILTRQGVPVLAETAAKAKEGVRKGAYVLVDTEGTPDVILMASGSEVQWAVAAA
KTLAGEGVKARVVSVPSLEWFEEQDAEYKEAVLPAAVKARVSVEAGVAMPWYKYLGSYGK
PVSIEQFGLQGDGAQNMIDLGITAEHVVEAAKASIAEAEAAK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaattcaaggagaccgagctcgacgagcgcgccatcaagatggcgaaggtcctt
tcggctgacgcggttgagaaggcgggctccggccaccccggctcccccgtctccctggcg
cccgtcgcctacacgctgtaccagcacttcatcaagcacgatccgaatgatcccaactgg
gaaggccgcgatcgcttcatcctttccggtggccacgcctccctcacccagtacgtccag
ctgtacttctccggttacggcgtgaccctggacgacctcaagagcttccgtggcagcgcg
gccacccgcaccccgggccacccggagtacggcctgaccccgggcatcgaaatgaccacc
ggtcctctgggtcagggtctcgcctccgccatcggcttcgcctacggcgagcgtttccag
cgcggtctgcttgacccggagaccccgaaggaagattccccgttctaccacaagatctgg
gccatctgcggcgaaggcgacatcgaggagggcatctccggcgaggccgcttccctggcc
gccaaccagaagctcggcaacctgaccgtgatcttcgacgccaaccgcatccaaatcgaa
ggcgacaccaacctggtgctggccgaggacgtgctcaagcgcttccaggcatacggctgg
tacaccgacgagttcagcttcatccagcccgacggctcctacaaggaggacatcgaaggc
ctggccgacgtcatcgccaaggccgagaaggccgctccggaccagccgaagctcatcaag
gtccactccctgatcgcctggccgaccccgggcaagaccaacgacccgtcctcccacggc
tccaagctgggcgccgaggccgtcgccggcctcaagaagctcctcggctacgatccggag
gagtccttccacgtcgacgaagaagccctggcccacgcccgcaaggtcgccgatcgcggc
ctggaagcccacaaggcctgggacgagaagttcgacgcctggcgcaaggccaacccggac
aaggccgccctgtacgaccgcctgaaggccggcgagctgccggaaggcttcgataaggcc
ctggacgaccttgaggccaccttcgaagtcggcaagaacgtcgccacccgcggcgcctcc
ggctccgtgctcaacgccatcgccgccgtcatgccggaactctggggcggctccgccgac
ctcggcggctccaacaagaccgacctcaagggcgccgccaccttcgccccggccgagtgc
gccaccgttcagtggccgaattgcaacgagttcggccgccagcttcacttcggcgtgcgt
gagttcgccatgggctgcatcaccaacggcatcctgctcggttcgcacacccgtccgttc
ggcggtaccttcttcatgttctccgactacgagcgttccgccgtccgtctggccgccctc
atgcagatcccgaacctgtacatctggtcccacgactccgtcgccgtcggcgaggacggc
ccgacccatcagccggtcgagcacctggcctccttccgcgcgattcctcagcttgaggtc
atccgcccggccgacgccttcgagaccgccgaggcctaccgctacttcttcgagaagaag
aacacgctgcccggcgccatgatcctgacccgtcagggcgtcccggtgctcgccgagacc
gccgccaaggccaaggaaggcgttcgcaagggcgcctacgtgctcgtggacaccgagggc
accccggacgtcatcctcatggcttccggctccgaggtccagtgggccgtggccgccgcc
aagaccctggccggcgagggcgtcaaggctcgcgtcgtgtccgtgccgtccctcgaatgg
ttcgaggagcaggacgccgagtacaaggaggccgtgctgccggccgccgtcaaggcccgc
gtctccgtcgaggccggcgtcgccatgccgtggtacaagtacctcggctcctacggcaag
cccgtctccatcgagcagttcggcctgcagggcgatggcgctcagaacatgatcgacctt
ggcatcaccgccgagcacgtcgtggaagccgccaaggcctccatcgccgaagccgaagcc
gccaagtga

DBGET integrated database retrieval system