KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1097Help
Entry
Blon_1097         CDS       T00794                                 

Definition
(GenBank) heat-inducible transcription repressor HrcA
  KO
K03705  heat-inducible transcriptional repressor
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Brite
KEGG Orthology (KO) [BR:bln00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bln03000]
    Blon_1097
Transcription factors [BR:bln03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Blon_1097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HrcA HTH_DeoR HTH_11 Ribosomal_L5 HTH_12 Type2_restr_D3
Motif
Other DBs
NCBI-ProteinID: ACJ52187
UniProt: B7GQV7
Position
1286100..1287218
Genome map
AA seq 372 aa AA seqDB search
MTQSRRMLVLRAVVEDYIRSQEPVGSTSLTRDHDLGVSSATIRNDMAALEDEGYLIQPHT
SAGRVPTEKGYRYFVDRLATVVPLSEAQRRGINSFLSGSVSLKDALQRSARLLSEITGQV
AVVTSPSLAKATLRHVEMVPVAMTTLLAVVITDTGRVAQHGLTIASMPAVDEINRLSNTV
NEQCVGLSLSKSAETVRSIAASAGYESVRGVADALADAFESMALDERANELYMSGTSHLA
HSRSLTDLAPLFDALEEQVVLMKLMSNLSEETNASGVGVAIGSEMHTPGLLHASVVSSGY
GRSGEAGEPAGNDPVGEPETESETESQTNDMEPIAFVGSIGPTHMDYAATMAAVRAVARY
LTAFLSEGRTQD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatcaagacgcatgctggtgctgcgcgccgtggtggaggattacatccgttct
caggagcccgtgggctccacttcgctgacgcgcgaccatgatctcggcgtcagttcggcc
accatccgtaacgacatggccgctctggaggacgaaggctatctgattcagccgcacact
tcggccggtcgtgtgcccaccgaaaagggctatcgatactttgtggaccgacttgctacc
gtggtgccgctcagcgaggcgcaacgccgcggcatcaacagcttcctgtccggatcggtg
agcctcaaggacgcgctgcagcgttcggcacgactcttgtccgaaatcaccggtcaagtg
gccgtagtcacctcgccatcgctggccaaggccacattgcggcatgtggagatggtaccc
gttgccatgaccacgttgctcgcggtggtgattaccgacaccggccgcgtggcccagcac
ggcctgaccatcgcatccatgcccgccgtggacgagatcaaccggctctccaacaccgtc
aacgaacaatgtgtcggactgtccctatcgaaatccgcggagaccgtgcgatccatcgcc
gccagcgccggctacgagtcggtgcgcggcgtggccgacgcgctggccgacgccttcgaa
tcgatggcattggacgaacgtgcgaacgaactgtacatgtccggcacctcgcacctggcc
cactcccggtccctgaccgatctggccccgctcttcgacgcgctggaagaacaggtcgtg
ctgatgaagctcatgagcaacctgagcgaggagacgaatgcatccggcgtgggcgtggcc
atcggctccgaaatgcacacccccggcctgctgcatgcttccgtggtcagcagtggctat
gggcgcagcggtgaggcgggcgaaccggcggggaacgatcccgtaggcgaacccgaaacc
gaatccgagacggagagccagacgaacgacatggaacccatcgccttcgttggctccata
gggccgacccacatggactatgcggccactatggccgccgtcagggccgtagccagatat
ttgaccgccttcctctccgaaggccggacccaagactga

DBGET integrated database retrieval system