KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1098Help
Entry
Blon_1098         CDS       T00794                                 

Definition
(GenBank) chaperone DnaJ domain protein
  KO
K03686  molecular chaperone DnaJ
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Brite
Chaperones and folding catalysts [BR:bln03110]
 Heat shock proteins
  HSP40 / DNAJ
   Blon_1098
Mitochondrial biogenesis [BR:bln03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    Blon_1098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP
Motif
Other DBs
NCBI-ProteinID: ACJ52188
UniProt: B7GQV8
Position
1287274..1288419
Genome map
AA seq 381 aa AA seqDB search
MADYYETLGVERGASDDEIKKAYRKLSRKYHPDIAGPEFEDKFKEVNNAYDVLSNPDKRR
MYDSGVDPNDPNAGAGGFSGAGFGDMSDVFSTFFGSAFGGGSQGPVPRTQPGRDALASAS
IDLKTAVFGGTAHVKINTFSLCQECGGSGAQGGAQPVTCPDCHGQGFMQKVVRTMLGQMM
TSAPCERCEGHGTIIQNPCPSCMGHGRVRTTRTVGVTVPAGINDNARLRLANQGEVGEGG
GAAGDLYIDIRIKADKQFTRDGDDLHCWIQVPMSWAVLGHDLSINTFDGEKTVSIPAGCQ
PEDTVTLKGLGVTNIRNKDERGNLIAHVNVLIPTKLNETERGLIEQFAASHDSGATHVSQ
ASRPQAGQKKGFFSKLKDALS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtggcagattattacgagacgctgggtgtggaacgcggcgccagtgacgacgagatcaag
aaggcataccgcaagctcagccgtaagtaccaccccgacatcgcgggccctgaattcgag
gacaagttcaaggaagtgaacaacgcctacgatgtgctgtccaatccggacaagcgccgc
atgtatgattcgggcgtcgacccgaacgatccgaacgccggtgccggcggcttctccggg
gcgggcttcggcgatatgagcgacgtgttctccacgttcttcggttccgcgttcggtggt
ggctcacagggcccggtgccgcgtacccagcccggccgcgacgccctggcctccgcgtcc
atcgacctgaagaccgccgtgttcggcggcaccgcgcatgtcaagatcaatacgttctcc
ctgtgtcaggagtgcggtggctccggtgcccagggcggcgcgcagccggtcacctgcccc
gactgccacggccagggattcatgcagaaggtcgtgcgcaccatgctcggccagatgatg
acctccgccccctgcgaacgttgcgagggccacggtaccatcatccagaacccgtgcccc
agctgcatgggccacggccgtgtgcgcaccacacgtaccgtgggcgtcaccgtgcccgcc
ggcatcaacgacaacgcgcgtctacgcttggccaatcagggcgaagtgggtgagggcggc
ggcgctgccggcgacctgtacatcgacattcgcatcaaagcggataagcagttcactcgc
gatggcgacgacctgcactgctggattcaggtgccgatgagctgggccgtgctcggccac
gatctgtccattaacacgtttgacggtgagaagaccgtgtccatcccggccggctgtcag
cctgaggatacggtgacgctgaagggactgggcgtcacgaacatccgcaacaaggacgag
cgtggcaacctcatcgcccacgtcaatgtgctgattcccaccaagctcaacgaaaccgag
cgcggcctcatcgaacagttcgccgcctcgcacgattcaggcgccacgcacgtctcccag
gcatcccgtccacaggctggccaaaagaaaggcttcttcagcaagttaaaagacgcactg
agctga

DBGET integrated database retrieval system