KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1101Help
Entry
Blon_1101         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arfaptin Herpes_UL6 SseC
Motif
Other DBs
NCBI-ProteinID: ACJ52191
UniProt: B7GQW1
Position
complement(1290226..1290606)
Genome map
AA seq 126 aa AA seqDB search
MPPEFWTAAITALVGSGGVGAIIGAVSSRRKDTAQIAAQACDILTDSVIKPLREQVDDQE
EQIEHLERQQRKYFALTAYTRSLFHWLQEFCEITDPAFMARHPKPGLPDELRADIAPETV
AARDAG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctccggagttctggacggcggcgatcaccgctctcgtcggcagcggtggagtgggc
gccatcatcggcgccgtctcctcgcgtcgcaaggacacggcgcagatcgccgcgcaggcg
tgcgacatcctgaccgattcggtcatcaagccattgcgtgagcaggtggacgaccaggag
gagcagatcgagcatctggagagacagcagcgcaagtacttcgcgctcacggcgtacacc
cgttcgcttttccactggctgcaggagttctgtgagatcaccgaccccgcgttcatggcg
cgccatccgaaaccgggcctgccggacgagctgcgcgccgacatcgcgcccgagaccgtc
gcggcgcgggatgccggctga

DBGET integrated database retrieval system