KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1106Help
Entry
Blon_1106         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sipho_tail Pilin_PilX
Motif
Other DBs
NCBI-ProteinID: ACJ52196
UniProt: B7GQW6
Position
complement(1297549..1298448)
Genome map
AA seq 299 aa AA seqDB search
MNDLWTLSPRYGELWAGDELVCRFNPADSSDRGLYITANGVEGWDTLPDAKVELHERGQG
DGAHDVPETDILYSARTVTVHYEAVGYSRADLLSLMRRINTAAHRSCRLRMVDGDEDTYC
EGYVAQMGRNSRWNPLLENDLTLHFVCPRPERLSWDARRFQLVPAWDAGLGLSYGSGDAG
LAYPLSYGRSAVDARNVCTLVNNGSSRAYPVFTVQGPWPDGVQLTFPGRDMSLDYSQAVG
SVPLVLDSRSRAASIGGLDVSRNLRQRGFPTVPPGGSVAVNLQSVGDGYVTVECRDTYM
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacctgtggactttgagcccgcgttacggggagctgtgggccggcgacgagctc
gtctgccggttcaatcccgcggattcgtccgaccggggcctgtacatcaccgccaacggc
gtggagggctgggatacgctgccggacgcgaaggtggagttgcacgaacgcggccagggc
gacggcgcgcatgacgtgcccgaaacggatatcctgtattcggcccgcaccgtgaccgtg
cactacgaggcggtcggctacagccgtgcggacctactctccctgatgcgccgcatcaac
accgcggcgcaccgctcctgcaggctgcgcatggtcgacggcgacgaggacacatactgt
gagggctacgtggcgcagatgggccgcaactcgcggtggaatcccctgttggagaacgat
ctgacattgcatttcgtgtgtcctcgtcctgagcgtttgtcgtgggatgcgcggcgtttt
cagttggttccggcgtgggatgcggggttgggcctgtcgtatgggagtggggacgcgggg
ctcgcgtatccgctgtcgtatgggcgttcggccgtggatgcgcggaacgtgtgcacgctc
gtcaacaacggttccagccgagcctacccggtgttcacggtacaaggtccgtggccggac
ggcgtgcaattgaccttcccgggccgtgacatgagcctggactattcgcaggcggtcggc
agcgtgccgctcgtgctggactcacggagtcgcgcggcgagcataggcggcctggacgtg
agccgcaacctgcgccagcgcggcttccccaccgtgccgccgggcggctcggtggccgtg
aacctgcaatccgtcggcgacgggtacgtgaccgtcgaatgccgtgacacctacatgtga

DBGET integrated database retrieval system