KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1109Help
Entry
Blon_1109         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SQS_PSY
Motif
Other DBs
NCBI-ProteinID: ACJ52199
UniProt: B7GQW9
Position
complement(1302183..1302677)
Genome map
AA seq 164 aa AA seqDB search
MALEVKRKRVDVDLILDQEKAEQVAALGAGLERAMAQHVTEGGNAAVKRIAKQIDKLRDE
VKDDTIRITLEALPLSQWRQVLEANIVTENGLPKQRIEDICADAIKLMARKTVPETPVEE
LANVMTELSDGQISPIWYAIRDLNAKLIDPKDALESASRIIRRQ
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggctctggaagtgaagcgcaagcgcgtggacgtcgatctgatcttggatcaggagaag
gccgaacaggtcgccgcattgggggccggcctggagcgcgccatggcgcagcatgtgacc
gaaggcggcaacgccgccgtcaaacgcatcgccaagcagatcgacaagctgcgcgacgag
gtgaaggacgacaccatccgcatcaccttggaggcgctgcctctttcccagtggcgtcag
gtgctcgaggcgaacatcgtcaccgagaacggcctgccgaagcagcgcatcgaggacatc
tgcgccgacgccatcaaactcatggcccggaagaccgtgccggaaaccccggtggaggag
ctggcgaacgtcatgaccgaactgtccgacggccagatttccccgatctggtacgcgatc
cgtgatctgaatgcgaagctcatcgacccaaaagacgcactcgaatcagcctcgcggata
atccgcagacagtaa

DBGET integrated database retrieval system