KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1125Help
Entry
Blon_1125         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACJ52215
UniProt: B7GQY5
Position
complement(1313899..1314141)
Genome map
AA seq 80 aa AA seqDB search
MESTIRLAFVIVSVIIGGMVLAVISLTAAATMNPTPEQTIIQKVETTGDVKRLCVEACTG
EHIEAMSFELIDQQSGGVMR
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
gtggagtccaccatcaggctcgctttcgtcatcgtcagcgtcatcatcggcgggatggtg
ctggccgtcatcagcctcaccgccgctgctaccatgaacccgacgccggaacagaccatc
atccagaaagtcgaaaccaccggtgacgtcaaacgtctatgcgtcgaagcttgcaccggc
gagcacatcgaagccatgagcttcgagcttatcgaccagcaatcaggaggcgtcatgcga
tga

DBGET integrated database retrieval system