KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1126Help
Entry
Blon_1126         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACJ52216
UniProt: B7GQY6
Position
complement(1314152..1314337)
Genome map
AA seq 61 aa AA seqDB search
MGEPIDLTQQALNALASSGLGNDSPAEAFVIGYQTGWQQAIDLCIEIETQLNKEDLKNAQ
A
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaaccgattgacctcacccaacaggcgctcaacgcgctggcctcatcgggtctg
ggcaacgacagtccggccgaggcgttcgtcatcggctaccaaaccggatggcagcaggca
atcgacctgtgcatcgaaatcgaaacacaactcaacaaggaggatctcaaaaatgcgcag
gcatga

DBGET integrated database retrieval system