KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1131Help
Entry
Blon_1131         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACJ52221
UniProt: B7GQZ1
Position
complement(1318773..1319705)
Genome map
AA seq 310 aa AA seqDB search
MTQSAPDMGKPPATPKTKTDTMEEPRLWPEIRQLIEADIQNAPRELQREIGPSELGTDCV
HCLAAKLAGWPERRSPGWLPFIGTCVHAHFEQMFRELNREPAHQFLYTSEDSVTGLGERW
RSEYRVTVGRLQGLHGGYDVTGSIDLWDRKTHSTIDWKIVGNTTVTKVKAHGPSQQYRVQ
ASLYGMGLQNEGELVERNCIYFLPRNKTSLGDALPWETRFGPEPGKWALARAQLLVNLMD
IIEQADGVGVRDSWIKQLPAAGPDKCFSCKGRVWPDMSALPEFDEKPWPDVPDKWLQLIP
LIESEYQFTE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagtcggcgcccgatatgggcaagccgccggcaacgccgaaaaccaagacggac
acgatggaggaaccacgattgtggccggagatccgccagctcatcgaagcggatatccag
aacgctccgcgtgagctgcagcgtgagataggcccgtccgaactgggcacggactgcgtg
cactgtctcgcggcgaaactggcgggttggccggagcgtcgttcgccgggttggctgccg
ttcatcggcacgtgcgtgcacgcgcacttcgagcagatgttccgcgagctgaacagggag
cctgcgcaccagttcctctacacgagtgaggacagcgtgaccggactcggggagcgctgg
cgcagcgaatatcgcgtcaccgtaggccgattgcagggcctgcacggcggctacgacgtc
accggttcgatcgacctctgggatcgcaagacccatagcaccatcgactggaagatcgtc
ggcaacaccacggtcacgaaggtcaaggcgcacggccccagccagcagtatcgtgtgcag
gcctcgctctacggcatgggactgcagaacgagggcgaactggtggagcgtaattgcatc
tatttcctgccccgcaacaagaccagtctgggtgatgcgttgccctgggagacgaggttc
ggcccggagcccggcaaatgggcgttggcccgagcccaactgctcgtcaacctcatggac
atcatcgaacaggcggacggcgtgggcgtgcgcgacagctggataaagcaactgcccgcg
gcgggccccgacaagtgcttctcatgcaaggggcgcgtgtggccggatatgagcgcgctt
cccgagttcgacgagaagccgtggccggacgtgcccgacaaatggctccaactcatcccc
ctaatcgaatccgaataccagttcaccgaataa

DBGET integrated database retrieval system