KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1133Help
Entry
Blon_1133         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PKcGMP_CC DivIC DUF641 FlgM
Motif
Other DBs
NCBI-ProteinID: ACJ52223
UniProt: B7GQZ3
Position
complement(1320165..1320548)
Genome map
AA seq 127 aa AA seqDB search
MTPSTIENTEAVNPDGELRQGLFAAQAARIVELQAEIASRQEEVDELKARILDSHPVGTY
QAGNLKVQVKPGARRINAGTFEKAYPATKYPGAYQLRPRPLSQLEKLLSADAVADYAMSG
KPMVVVS
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgactccatcaaccattgaaaacacagaggccgtgaacccggacggggaattgcgccaa
ggattgttcgccgcgcaggcggctcgcatcgtcgaactgcaggccgagatcgcgtcccgt
caggaggaggtcgacgagctgaaggcccgtatcctcgactcgcatcctgtcggcacctac
caggccggcaacctgaaggtgcaggtcaagccgggcgcgcgccgcatcaacgccggcacg
ttcgaaaaagcctacccggccaccaagtatcccggagcctaccagttgcggccgcggccg
ctcagccagttggagaagctgctgtcggcggacgcggtggccgattacgcgatgagcggc
aagcctatggtggtggtctcatga

DBGET integrated database retrieval system