KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1134Help
Entry
Blon_1134         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACJ52224
UniProt: B7GQZ4
Position
complement(1320710..1321039)
Genome map
AA seq 109 aa AA seqDB search
MSKPINEPRLVQQVLIADEDLSFELAALVPPANGITNAASTFIDKATKLLLSDKIMLTNE
QHTAIATAIAVAQLTVKEGAAVSKLLRNPDASTDIIAGLRLASEDRHDA
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccgatcaacgaaccccgtctggtgcagcaggtgctgatagcggacgaggat
ctgagtttcgaactggcggctttggtgccgccggcgaacggcatcacgaacgcggccagc
acgttcatcgacaaggccaccaagctgttgctgtccgacaagatcatgctcaccaacgag
cagcatacggccatcgcgacggccatcgccgtcgcccaactgaccgtcaaggaaggcgcg
gccgtgtcgaagctgctgcgcaacccggacgcttcgacggacatcatcgccggactacgc
ctcgcctccgaggacaggcatgatgcctga

DBGET integrated database retrieval system