KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1135Help
Entry
Blon_1135         CDS       T00794                                 

Definition
(GenBank) endodeoxyribonuclease RusA
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RusA
Motif
Other DBs
NCBI-ProteinID: ACJ52225
UniProt: B7GQZ5
Position
complement(1321036..1321464)
Genome map
AA seq 142 aa AA seqDB search
MPKGRPRVYNGHAMTPKRTVRAEERLFAEFRLKYPQAKPYQCPVRLEAEFWMSHRGRPDL
DNLLKLVLDSLNGVAYVDDAQVVESHACKRMPDMWVYGAKGRYRRRKSGDPYTCCGHEYE
PHLYIRIKPLPEREPNKQGEQS
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaaggggcgtccccgcgtctacaacgggcacgcgatgaccccgaaacgcaccgtc
agggcggaggaacgcctgttcgccgaattccggctcaaatacccgcaggcgaaaccatac
cagtgcccggtcaggttggaggccgaattctggatgagccatcgcggccgcccggatctc
gacaacctgctgaagctggttttggactcgctgaacggcgtcgcctacgtggacgacgcg
caggtcgtcgaatcccatgcgtgcaagaggatgcccgacatgtgggtgtacggggcgaaa
ggccgttaccggaggcgcaagagcggcgacccctacacctgttgcgggcacgaatacgag
ccgcacctctatatccgtatcaaaccgctccccgaacgggagccgaacaagcaaggagaa
caatcatga

DBGET integrated database retrieval system