KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1150Help
Entry
Blon_1150         CDS       T00794                                 

Definition
(GenBank) fructosamine kinase
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fructosamin_kin APH EcKinase DUF1679
Motif
Other DBs
NCBI-ProteinID: ACJ52240
UniProt: B7GR10
Position
complement(1331148..1331939)
Genome map
AA seq 263 aa AA seqDB search
MATYRKSRAFAPEGFFECEGRGLEWLGAAHAQGGPRVVQVYGWGKDYLDIERVGSASPTP
QAARAFGAALAHMHDTGAEYFGSAPDGYNGTCYFGPLQDPVKMDTGEWTDPISYFADGRL
RPMVNLGVRRGELDKRDVELTERVIEALPDLMGRAAADKPARIHGDLWSGNVMWTADSGQ
SEAVLIDPAAHGGHREEDLSMLHLFGMSYLSEITEGYQSVHPLKAGWQERITLWQLYPIA
GHCVFFGGGYVNEYRSMCRSLLK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggccacgtatcgcaaaagcagggcattcgcaccggaaggattcttcgaatgcgagggc
cgagggctcgaatggttgggagcggctcatgcgcagggcggcccgcgcgtggtgcaggta
tacggctggggcaaggattatctggatatcgaacgtgtgggtagcgcgtcccccacgcct
caggcggcacgagcttttggtgcggctctggcccatatgcatgatactggtgccgaatat
ttcgggtctgcgcctgacggatataacggcacatgctacttcggaccattgcaggaccca
gtgaaaatggataccggcgagtggaccgacccgatcagctatttcgctgatggacggctg
cgcccgatggtcaaccttggtgtgaggcgtggcgagctggataagcgcgatgttgagttg
actgagcgcgtgattgaagcgctgccggacctgatgggccgcgccgcagccgacaagccg
gcgcgcatccacggcgatctgtggagcggcaatgtgatgtggaccgccgattccgggcag
tccgaggccgtgctcatcgatccggcggcacatggcggtcatcgcgaggaggatctgtct
atgctgcacctgttcggcatgagctatctgagcgaaatcaccgagggctaccagtccgta
catccgctgaaggccggatggcaggagcgtatcacgctctggcagctctaccccatcgcc
ggccattgcgtcttcttcggcggcggctacgtcaacgaataccgctccatgtgtcgttcc
ctgctgaagtga

DBGET integrated database retrieval system