KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1165Help
Entry
Blon_1165         CDS       T00794                                 

Definition
(GenBank) major intrinsic protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP Renin_r ODV-E18 T4SS_CagC
Motif
Other DBs
NCBI-ProteinID: ACJ52255
UniProt: B7GR25
Position
complement(1347384..1348352)
Genome map
AA seq 322 aa AA seqDB search
MEETKQQPLALRVCAESAGSFLLCFAIYAFSTWGSAVYGINIVFFALATGLAYAAVTAIF
SRVSGGQLNPAITVASVLVSKTKILDGILYVIAQVIGAIAAGFAVVKLLPTSEQVAAKVW
LTPAVNGFENGSVSYSLLTQYGITFSITLAIVVEVVASLIVVATAMSSLGDHGESSDRHI
IALGLAYGLAAAISYPVTGAGLNPARSTGIALAAMNEGLTQNPLQQLWVFWISPVLAASV
VALVMIIAQMMTTPKVPAAADLPQTDADANADTLDDGEFFDQAASSDGDSAEKDVAEESK
EAEVGNQQADSQGDADEGVERH
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaccaagcaacagccgctggctctgcgcgtgtgcgccgaatcggccggcagc
ttcctgctgtgctttgcgatttacgccttctccacatggggttcggccgtatatggcatc
aatatcgtgttcttcgcgttggctaccggcttggcatatgccgcagtcaccgccatcttc
tcccgcgtgtccggtggtcagctgaatccggccatcaccgtagcctccgtgctggtttcc
aagacgaaaatcctggatggcatcctctatgtgatcgctcaggtcatcggtgccatcgcc
gccggcttcgccgtggtcaagctgctgcccacatccgagcaggtagctgccaaagtgtgg
ctgactccggccgttaacggtttcgaaaacggctccgtgtcttactcgctgctgacccag
tatggcattacgttctcgattacgttggcgattgtcgtcgaggtcgttgcctctctgatt
gtcgttgccaccgccatgtcttctctgggtgatcacggcgagtcctcggaccgtcatatc
attgccttgggtcttgcctatggtctggccgccgccatcagctacccggttaccggtgcc
ggtctcaatcccgcccgttccaccggtatcgcactggccgcgatgaatgagggccttacg
caaaatccgctgcagcagctgtgggtattctggattagcccggtcttggccgcctctgtg
gtggcgttggtcatgatcatcgctcagatgatgaccactcccaaagtgccggctgccgcc
gatcttccacagacggatgccgatgcgaacgcggacacactcgacgatggcgaattcttc
gatcaggccgcctcgtctgatggcgattcagcggaaaaagatgttgccgaagagtccaaa
gaagctgaagtaggtaatcagcaggccgattcccaaggcgatgccgatgaaggagtcgaa
cgccactga

DBGET integrated database retrieval system