KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1175Help
Entry
Blon_1175         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_17 Tn916-Xis AbiEi_4
Motif
Other DBs
NCBI-ProteinID: ACJ52265
UniProt: B7GR35
Position
complement(1361232..1361465)
Genome map
AA seq 77 aa AA seqDB search
MGVHRVSRRKEPDMADKPFVPVEHRLALTVPEAAALCGIPEKVVRAAVVHGDLRHFEKGS
TTARIRRTDLEDWVALL
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtccatcgtgtttcccgtcgtaaggagcctgacatggccgacaagccgttcgtc
cccgtcgagcatcgtctcgcgctgaccgtccccgaggcggcggccctgtgcggcatcccg
gagaaggtggtgcgcgccgcggtcgtgcacggcgatctgaggcatttcgagaaggggtcc
acgacggcccgcatccgcaggacggatctggaggactgggtggccttgctgtga

DBGET integrated database retrieval system