KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1177Help
Entry
Blon_1177         CDS       T00794                                 

Definition
(GenBank) SNF2-related protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNF2_N ResIII Helicase_C
Motif
Other DBs
NCBI-ProteinID: ACJ52267
UniProt: B7GR37
Position
1361851..1363245
Genome map
AA seq 464 aa AA seqDB search
METPLHDYQKQAIRFALKAFASPSRGCGLFLEPGLGKTLTSIAVMDIMHAADPHARFLVI
APALVARNSWPDELERWKGMHSLTWAAAVGTPRQRSKALDADADVTVIGQDNLKWLDGKV
GDWPWKGIVVDELSGYKTPRSNRGLILRRHARQAKWTLGLTGTPATKNLLDLWGEIAVID
RSETLERSMTRYRDRWFTPGRYIDMGGRRQPIDYTPRDGAQQEILDLIEPFCLSMKASDR
LPGLPSMIETDHWLDMPKPTRDTYDRLRRQMVADLDDGTTVTAANAGVLTAKLAQLTCGC
LYPDADDPEGTIRHVDDVKLDALADIIGAADGPVLVFYQFTDELERMRARFPGMREVHEQ
GVLEEWRNGRVPLLAAHPQAAKYGLNIQDGGHEIVWTSLPWSFDDYRQACDRLHRQGQKR
TVRVHRLLESNTVDRRKLDVLTGRMMLHEAVMDAVEGETTGINI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccccattgcacgactaccagaaacaggccatccggttcgccctgaaggcgttc
gcctccccgtcccgcggctgcggcctgttcctcgaacccgggctcggcaagacgctgacc
agcatcgccgtcatggacatcatgcacgcggccgacccgcacgcccggttcctcgtcata
gcgcccgcattggtggcccgcaactcgtggcccgacgagctcgaacgctggaagggcatg
cactccctgacatgggcggccgccgtcggcacgccgcggcaacggtcgaaggcgctggac
gccgacgcggacgtgaccgtcatcgggcaggacaacctcaaatggctggacgggaaggtg
ggggactggccgtggaagggcatcgtcgtcgacgagctgtccggctacaagacgccgaga
agcaaccggggactcatcctgcgccggcacgcgagacaggcgaaatggacgctcggcctg
accggcacgcccgccaccaaaaacctattggacctgtggggcgagatcgcggtcatcgac
cggtccgaaacgttggaacggtccatgacccgctaccgggaccgctggttcacgcccgga
cgctacatcgacatgggcggccgccggcagcccatcgactacacgccccgcgacggcgcc
caacaggagatcctggacctcatcgaaccgttctgcctgagcatgaaggcgtccgacagg
ctgcccgggctcccgtccatgatcgagaccgaccattggctcgacatgccgaaaccgacc
cgggacacgtacgaccggctgcgtcggcagatggtcgccgacctggatgacgggacgacc
gtgaccgccgccaacgcgggcgtgctcaccgcgaagctcgcccaactgacgtgcggatgc
ctgtacccggacgcggacgatccggaagggacgatccggcacgtggacgacgtgaagctc
gacgcgctcgcggacatcataggcgcggcggacgggccggtgctcgtgttctaccagttc
accgacgaactggaacgcatgcgcgcacgcttccccggcatgcgcgaggtgcacgagcaa
ggcgtgctggaggaatggcgcaacggccgcgtcccgctcctggccgcccacccgcaggcc
gcgaaatacgggctgaacatccaggacggggggcatgagatcgtgtggaccagcctgccc
tggtcgttcgacgactaccgtcaggcatgcgaccgattgcaccggcaagggcagaaaagg
acggtacgcgtccaccggttattggagtcgaacaccgtggaccgtcgcaagctcgacgta
ttgaccggccgcatgatgctgcacgaggcggtcatggacgcagtggaaggagagacgacg
ggcatcaatatttga

DBGET integrated database retrieval system