KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1201Help
Entry
Blon_1201         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1524
Motif
Other DBs
NCBI-ProteinID: ACJ52290
UniProt: B7GR60
Position
1385862..1386791
Genome map
AA seq 309 aa AA seqDB search
MRRGDGGGPFRRLLSMIATMVMVGVLVVVLVSSGGWRTVSETFGIGNPDASTAALTEPRK
GDAGRNPDAKSLSGLLSLFGVHTGGEADAGAKDTGKTPDTAPTGDAAAWRTQLDAAGRIG
TANARPGGYDRETRFGGWAPSGCGKATTRDTILARDLTGVKKDSSCRVVSGTLHDPYTGG
TIGFRRGVKTSADVQIDHVVSLYDAWASGARDWDQAKRVEYANDPDVLLASDGPANMAKG
SGIDVNGRSEYLTQHTGAPDIWMPDNKAYRCDYMAKRVSIKAKYGLTMTAREKQQTITYL
AQCVAGKNQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgtggcgatgggggaggcccgttccggcggttgctgtccatgatcgcgaccatg
gtcatggtgggcgtgctcgtcgtcgtgctcgtctcctcgggaggctggcggaccgtgtcc
gagacgttcggcatcgggaacccggacgcgtccacggccgcattgaccgaaccgaggaag
ggggatgcgggacgcaacccggacgccaaaagcctgtcgggcctgctctccctgttcggc
gtccatacgggcggggaggcggacgcgggggcgaaggacacggggaaaaccccggacacg
gccccgacgggggatgcggccgcatggcggacccagttggacgcggccggccggataggc
acggcgaacgccaggccgggcggctacgaccgtgagacgcggttcggcggctgggcgccg
tccggctgcgggaaggcgaccacgagggacacgatcctcgcccgcgacctgaccggcgtg
aaaaaggactcctcatgccgggtcgtgtcgggcacgctgcacgacccgtacacgggcggg
accatcgggttcagacggggcgtgaagacgagcgccgacgtgcagatcgaccacgtggtg
tccctgtacgacgcttgggcgtccggcgcccgcgactgggaccaggcgaaacgcgtcgaa
tacgcgaacgatccggacgtgctcctcgcctcggacgggccggcgaacatggcgaagggg
agcggcatcgacgtgaacggacgatccgaatacctgacgcagcatacgggcgcacccgac
atctggatgccggacaacaaggcgtaccggtgcgactacatggcgaaaagggtgtcgatc
aaggccaagtacgggctgacgatgaccgctcgagagaaacagcagaccatcacctacctc
gcgcaatgcgtggcgggcaaaaaccagtag

DBGET integrated database retrieval system