KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1204Help
Entry
Blon_1204         CDS       T00794                                 

Definition
(GenBank) CHAP domain containing protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CHAP DUF4131
Motif
Other DBs
NCBI-ProteinID: ACJ52293
UniProt: B7GR63
Position
complement(1388153..1388872)
Genome map
AA seq 239 aa AA seqDB search
MTADTRRDRTRLRRGRARQRHIALLLLFALAASGMGAWLANPAPATADTTVRASIGVKGR
PDPFPAADRDRTRTDLTADGTWDMGDRPKGRLTIIHADNPVVRDLINGRDEDRTPAGFDP
DHATGDTGNTYAYGQCTWWAYVRRTQLGLPVGSRLGDGGMWADSAKALGYWVDDTPRQGD
VIVFTPAQVNNAWGHVAIVEKVNGDGSIEISEANVNGQVGPFRRAIEAKQTHEYQYIHY
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggacacgagacgggaccggaccagactgcggcgcgggcgcgccaggcagcgg
catatcgccctgctcctcctgttcgcactcgcggcatcgggcatgggcgcatggctcgcg
aaccccgcgcccgcgacggcggacacgacggtccgcgcctcgatcggcgtgaagggccgt
cccgacccgttccccgccgcggaccgcgaccggacgcgcacggacctgacggcggacggc
acatgggatatgggcgaccggccgaagggcaggctcaccatcatccacgcggacaatcca
gtggtccgcgacctgatcaacgggcgcgacgaggaccggacgccggccggattcgatccg
gaccatgcgaccggcgacacgggcaacacatacgcgtacgggcaatgcacatggtgggcg
tacgtgcggcgcacgcaactgggattgccggtcggcagccggctgggcgatggcggcatg
tgggccgattccgccaaggcgctcggctattgggtggacgacaccccccggcagggggat
gtgatcgtgttcactcccgcgcaggtcaacaacgcatgggggcacgtcgccatcgtggag
aaggtcaacggcgacggttccatcgagatcagcgaagcgaacgtgaacgggcaggtcggc
ccgttccgacgcgccatcgaggcgaaacagacgcacgaataccagtacatccactattag

DBGET integrated database retrieval system