KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1206Help
Entry
Blon_1206         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5-ATPase
Motif
Other DBs
NCBI-ProteinID: ACJ52295
UniProt: B7GR65
Position
1389988..1390341
Genome map
AA seq 117 aa AA seqDB search
MRSVEVAAAPQIVQPIRDGVSKLCGFVTGNAALATLLVLVGAGVIITCVVLLVLRKWWPS
TQIGQALQGGGTIGWCCAGITFGLCGILPSQILPFVAGLVAMLFQIVLNIIAQVFGL
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagcgtggaagtcgccgccgcaccccagatcgtgcagcccatcagggacggcgtg
tcgaagctgtgcggtttcgtgacgggcaacgcggcgctcgcgaccctgctcgtcctggtc
ggcgcgggcgtgatcatcacctgcgtcgtgctgctcgtcctgcgtaaatggtggccgtcc
acgcagatcgggcaggcgttgcaggggggaggcacgatcggatggtgctgcgcgggcatc
acgttcggcctgtgcggcatcctgccctcccagatcctcccgttcgtcgccgggctggtc
gccatgctgttccagatcgtgttgaacatcatcgcccaggtgttcggactgtag

DBGET integrated database retrieval system