KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1213Help
Entry
Blon_1213         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACJ52302
UniProt: B7GR72
Position
1396315..1396773
Genome map
AA seq 152 aa AA seqDB search
MVLTPYETFDESSGVHVLWDSSRDMPSGMTAREFDRRAGRLLALLPRAAAGPAGMRLRAG
SDHAGPDAHPYDATVLHVWELWRMEASGLSARIPGLSDAFVSADGLANLVVEEESDLSDA
AAAATGAGWPLLRVWMRGETDPLPYRFLLVRP
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggttctcaccccgtatgagacgttcgacgaatcgtcgggcgtgcacgtcctgtgggat
tcgagccgtgacatgccgtcgggcatgacggcccgcgagttcgaccggcgtgcggggcgt
ctgctcgccctgctgccgcgcgcggcggccggcccggccggcatgcgcctgcgtgcgggt
tcggatcatgcggggccggacgcgcacccgtacgatgcgaccgtattgcatgtgtgggag
ttgtggcgtatggaggcttcggggctttcggcgcgcatcccgggcctgtcggacgcgttc
gtgtccgcggacggtctcgcgaacctggtcgtggaggaggagtcggacctgtccgatgcc
gcggccgccgcgacgggcgcgggctggccgctgctgcgcgtgtggatgcgcggcgagacg
gatcctctcccgtaccgtttcctgctcgtccgcccctag

DBGET integrated database retrieval system