KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1214Help
Entry
Blon_1214         CDS       T00794                                 

Definition
(GenBank) transcriptional regulator, XRE family
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_31 HTH_26 HTH_19 MarR_2 HTH_24 HTH_37
Motif
Other DBs
NCBI-ProteinID: ACJ52303
UniProt: B7GR73
Position
complement(1396824..1397375)
Genome map
AA seq 183 aa AA seqDB search
MEDGNVRATLDMLAGLGLEVRVMRETPFLAVVENPAIPLRRVAVAAPDGDGSARAAMFET
DPDTGRNRPHGDSAAVPRDDPWPAVAGMCRTWPAGLGALGDAAGLTRAELARRTGIAASR
ISEYARPRPGRADPGNMTLRTARALARALGVTIDDLYDAMAIRIPENGPTVRQAGTSDPV
RRA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgggaacgtgagggcgacgctcgacatgctcgccggactgggattggaagtg
cgcgtgatgcgcgagacgccgttcctcgcggtcgtggagaaccccgccatcccgttgcgc
agggtcgccgtcgccgccccggacggggacgggtccgcccgggccgccatgttcgaaacc
gatccggacaccggccgcaaccggccgcacggggattccgcggccgtcccccgcgacgat
ccgtggccggcggtcgccggcatgtgccggacatggccggccggcctcggcgcgctcggg
gacgccgccgggctcacccgggccgaactcgcccgcaggacggggatcgcggcctccagg
atcagcgaatacgcccggccgcgccctgggcgcgcggaccccggcaacatgacgctgcgc
accgcccgcgccctggcccgcgcgctcggcgtcaccatcgacgacctgtacgacgccatg
gccattcgcataccggaaaacggaccgacggtccgacaggcgggaacatccgatccggtc
cgccgggcatga

DBGET integrated database retrieval system