KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1215Help
Entry
Blon_1215         CDS       T00794                                 

Definition
(GenBank) DNA methylase N-4/N-6 domain protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N6_N4_Mtase UPF0020
Motif
Other DBs
NCBI-ProteinID: ACJ52304
UniProt: B7GR74
Position
1397706..1399022
Genome map
AA seq 438 aa AA seqDB search
MHPRMHTDAYRPAGMHTGPMPAPADAYTGPMRPFIDHDGLTLYNTDARRLPDLLDAPADA
IVTDPPYELGLGTAGEVKRWDSTGIAFDPEFWTAMLGTVRPGAFALVFGSPRTWHRLACA
MEDAGWLIRDQISWLYASGMPKGEWGDHAVDRALGVRDDRTGVIRDSASLERNVAYTERY
EAKTREARPWRGFNPALKPAWEPILVAQRPRESMLGRNLMDHGTGALNVAACALDADMGE
LGRRYRLNATAGGRPDAPRGGDTFRDSGTPRPMGPRIPGRHPSNVLMDKAMARLLPADAP
RFYYCPKAQDRPIRALERLVRPRTRDKAWKACCARLGLESGADAYPACLLDAEALALTVP
VGERRLAHPTVKPLDLTRWLARLACPPHGLVLDPFAGSGTTLDACRREGLRCAATELDPT
YLPLTADRLERPASLPLF
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcatccccggatgcatacggatgcatacaggccggccggaatgcatacaggcccgatg
cccgccccggcggacgcatacacggggcccatgagaccattcatcgaccatgacggcctg
accctgtacaacacggatgcccgccgcctgcccgacctcctcgacgcgcccgcggacgcg
atcgtcaccgacccgccctacgagctcggcctgggcaccgcgggcgaggtgaaacgctgg
gactccaccggcatcgccttcgacccggaattctggacggccatgctcggcacggtccgc
cccggcgcgttcgccctcgtgttcggctcgccccgcacctggcaccggctcgcctgcgcc
atggaggacgcgggctggctgatccgcgaccagatcagctggctgtacgcgtcaggcatg
ccgaaaggcgaatggggcgaccatgcggtcgaccgggcgctcggcgtgagggacgaccgg
accggcgtcatacgggactccgcgtccctggaacgcaacgtcgcctacacggaacgctac
gaggcgaagacccgcgaggcgcggccctggcgcgggttcaatccggcgctcaaacccgca
tgggagccgatcctcgtcgcccagcgcccccgcgagtccatgctcggccgcaacctcatg
gaccacgggacgggcgccctgaacgtggccgcctgcgccctggacgcggacatgggggag
ctggggcgccgctaccggctcaacgcgaccgccggggggcgtccggacgcgccgcgcggc
ggcgacacgttccgtgattcgggcacgcccaggcccatggggccgcgcataccgggccgc
cacccgtcgaacgtcctcatggacaaggccatggcccggctcctgcccgccgacgcgccg
cgcttctactactgtccgaaagcgcaggacaggcccatacgcgccctggaacgcctcgtc
cgcccccggacacgggacaaggcgtggaaggcgtgctgcgcgcgcctgggactcgaatcc
ggggcggacgcgtaccccgcgtgcctgctcgacgcggaggcgctcgccctgaccgtgccg
gtgggcgaaagacggctcgcccatccgaccgtcaaacccctggacctgacccgatggctc
gcccgcctcgcatgcccgccccacggcctcgtcctcgacccgttcgccggctccggcacc
acgctggacgcatgccggcgggaaggcctgcggtgcgcggccacggagctcgaccccacg
tacctgccgctcacggccgaccggctcgaacgccccgcaagcctcccgctcttctag

DBGET integrated database retrieval system