KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1377Help
Entry
Blon_1377         CDS       T00794                                 

Definition
(GenBank) Selenocysteine lyase-like protein
  KO
K04127  isopenicillin-N epimerase [EC:5.1.1.17]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln01100  Metabolic pathways
bln01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bln00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Blon_1377
Enzymes [BR:bln01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.17  isopenicillin-N epimerase
     Blon_1377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Hydantoinase_B
Motif
Other DBs
NCBI-ProteinID: ACJ52465
UniProt: B7GRN5
Position
1546181..1546840
Genome map
AA seq 219 aa AA seqDB search
MDEGDAPVTIDADEDGVVDAVTAQMSERTSFIVLDQITSATAMLFPAQRIAAEAHRRGIR
ILVGGAHAPAQLADPVGGLQSDWWGGNFHKFPCAPRGTALLVIPPEGGQDGQDLWPLIDS
WGFADPFPERFDEQGTQDLCGPIAAPESLREIERLWGWDVVRRYMSDLADYAERRVSEAA
SEVGGELYLRLTAHAYVTTDAIDRFAEQSIPTIVGWLRG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggatgagggagatgcgccagttaccattgacgccgacgaggatggcgtggtcgacgcc
gtgaccgcgcagatgagcgagcgtacgtcgttcatcgtgttggaccagatcacttccgcc
accgctatgctgtttccggcccagcgcatcgccgccgaagcccatcgccgcggcatccgc
attttggttggtggcgcgcacgctcccgcccaactggccgatccggtcggcggactgcag
tccgattggtggggcggcaattttcataagttcccgtgtgcgccgcgtggcacggcattg
ctggtgattccgcccgaaggcggtcaggatggtcaggatttgtggccactgatcgactcg
tggggtttcgccgacccgttcccggagcgattcgatgagcaaggcacccaggatttatgc
ggtccgattgccgcgcccgagtccctgcgcgagatcgagcgactgtggggctgggatgtc
gtgcgccggtacatgtccgatcttgccgattacgcggagcgtcgggtatccgaggcggcc
agcgaggtcggcggcgaactgtacctgcgcctcaccgcccacgcctacgtcaccaccgac
gccatagaccgcttcgccgaacaatctatcccaaccatcgtcggatggctgcgtgggtaa

DBGET integrated database retrieval system