KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_2401Help
Entry
Blon_2401         CDS       T00794                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln00010  Glycolysis / Gluconeogenesis
bln00052  Galactose metabolism
bln00500  Starch and sucrose metabolism
bln00520  Amino sugar and nucleotide sugar metabolism
bln00521  Streptomycin biosynthesis
bln01100  Metabolic pathways
bln01110  Biosynthesis of secondary metabolites
bln01120  Microbial metabolism in diverse environments
bln01130  Biosynthesis of antibiotics
bln01200  Carbon metabolism
Module
bln_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Blon_2401
   00052 Galactose metabolism
    Blon_2401
   00500 Starch and sucrose metabolism
    Blon_2401
   00520 Amino sugar and nucleotide sugar metabolism
    Blon_2401
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Blon_2401
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Blon_2401
Enzymes [BR:bln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Blon_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACJ53456
UniProt: B7GNV0
Position
2686688..2687707
Genome map
AA seq 339 aa AA seqDB search
MSFASIIHQHTVISVDIGGTKIAAGLMCVDLDEQGRPRDMPALIRRYVIPTKARLGGTSV
LQRVVQAIRQCLDDGEIPFPLLGIGVASAGVIDGNGSVVSATSLIPGWAGIQLQAELSAT
FNVPAIVIGDVQAHALGEAHWGCGRQYQSLLVAAIGTGIGGAIIIDGKLVRGVHGACGHI
GHLPHPDAIGISCSCGCEGHVESIASGTGIADNYRRALQQNGHNTLPTDINGRAIAELAS
QGSTEAVTSITLAGTSLGDVLGGLINALDPDAVILSGSVVHSGELWMKSVKQGIQRQTLG
ILSRTPVLTGTLGGRAPLIGATSALCADLRSNKEQKYEY
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgcaagcataatccatcagcatacggtgatatccgtggacatcggcggcacc
aaaatcgccgctggtctcatgtgcgtagacctcgacgaacaaggaagaccgcgggacatg
ccagcgttgattcgacggtacgtcataccgacgaaagcacgtctcggcggcacctccgta
ttgcaacgcgtcgttcaagccattcgccagtgtctggacgatggtgagattcctttccca
ctattggggatcggtgtagcgagcgcaggagtcattgacggcaacggttcggtggtatca
gccacttcgttgattcccggttgggccggtattcaactgcaagccgaattatcggcaacg
ttcaacgtgcctgccatcgtcatcggagatgttcaggcacacgcccttggtgaagcgcac
tggggatgcggacgacaataccaatcactactggtcgccgccatcggcaccggtatcgga
ggcgcgataatcatcgacgggaaactggtacgcggcgtccacggagcctgtggccatatc
ggccatctgccgcatcccgacgccattggtatatcctgctcatgtggatgtgagggccat
gtggagtcaatcgcctcaggtaccggcattgccgataattatcgacgtgctctgcaacag
aacggacacaatactctccccaccgacatcaatggacgcgctatcgccgaactggccagt
caaggtagtacggaagccgtaaccagtatcactctggccggcacgagtctcggcgatgtt
cttggcggactaatcaatgcccttgatcccgatgccgtgatcctttccggctccgtagtc
cattctggagagctatggatgaaatctgtgaaacaaggcatccaaagacagaccttgggc
attctttcccgaacaccggttttgacaggaacactcggcggcagagcccctctcatcgga
gcaacatcagctctgtgcgccgacctcagatcaaataaggagcagaaatatgaatactaa

DBGET integrated database retrieval system