KEGG   Bifidobacterium longum NCC2705: BL0951
Entry
BL0951            CDS       T00094                                 

Symbol
pfl
Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00620  Pyruvate metabolism
blo00640  Propanoate metabolism
blo00650  Butanoate metabolism
blo01100  Metabolic pathways
blo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:blo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BL0951 (pfl)
   00640 Propanoate metabolism
    BL0951 (pfl)
   00650 Butanoate metabolism
    BL0951 (pfl)
Enzymes [BR:blo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     BL0951 (pfl)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: AAN24763
UniProt: Q8G5Q3
Position
complement(757135..759549)
AA seq 804 aa
MKMRNLQPHLRSDMTAVENAAVSQEELDAKAWAGFTEGNWQKDIDVRDFIQKNYTPYEGD
ETFLAPATEKTKHLWKYLDDNYLAVERKQRVYDVDTHTPADVDAFPAGYIDSPEVDNVVV
GLQTDVPCKRAMMPNGGWRMVEQAIKEAGKEPDPEIKKIFTKYRKTHNDGVFGVYTKQIK
VARHNKILTGLPDAYGRGRIIGDYRRVALYGVNKLIAFKKRDKDSVPYRNDFTEPEIEHW
IRFREEHDEQIKALKKLINLGNEYGLDLSRPAQTAQEAVQWTYMGYLASIKSQDGAAMSF
GRNSAFLDCYIERDLQAGKITETDAQELIDNIVMKLRIVRFLRTKDYDSIFSGDPYWATW
SDAGFGDDGRSMVTKTSFRLLNTLTLEHLGPGPEPNITIFWDPKLPEAYKRFCAKISIDT
SAIQYESDKEIRSHWGDDAAIACCVSPMRVGKQMQFFAARVNSAKALLYAINGGRDEMTG
MQVIDKGVIEPITPEADGTLDYEKVKNNYEKALEWLSETYVMALNIIHYMHDKYAYESIE
MALHDKEVYRTLGCGMSGLSIAADSLAAVKYAKVYPIYNKDAKTLEGHEYEYVEGADDDL
IVGYRTEGEFPVYGNDDDRADDIAKWVVSTVMGQVKRLPVYRGAVPTQSILTITSNVEYG
KNTGSFPSGHAKGTPYAPGANPENGMDSHGMLPSMFSVGKIDYNDALDGISLTNTITPDG
LGRDEDERIGNLVGILDAGNGHGLYHANINVLRKETMEDAVEHPEKYPHLTVRVSGYAVN
FVKLTKEQQLDVISRTFHQGAVVD
NT seq 2415 nt   +upstreamnt  +downstreamnt
gtgaagatgcgaaacctacaaccccatttaaggagtgacatgaccgcagtggaaaatgca
gctgtctcccaggaggagctcgacgccaaggcgtgggccggcttcaccgagggcaactgg
cagaaggatattgacgtccgcgacttcatccagaagaactacaccccgtacgagggcgac
gagacattcctggctcctgccaccgagaagaccaagcacctgtggaagtacctcgacgac
aactacctggccgtggagcgcaagcagcgcgtctacgacgtggacacccataccccggcc
gacgtcgacgccttcccggccggctacatcgactccccggaagtcgataacgtggtcgtt
ggcctccagaccgacgttccctgcaagcgcgcgatgatgccgaacggtggctggcgcatg
gtcgagcaggccatcaaggaagccggcaaggaaccggatccggagatcaagaagatcttc
accaagtaccgcaagacccacaacgacggcgtcttcggcgtgtacaccaagcagatcaag
gtcgcccgccacaacaagatcctcaccggtctgccggacgcctacggccgtggccgcatc
atcggcgactaccgccgcgtcgccctgtacggcgtgaacaagctcatcgccttcaagaag
cgcgacaaggactccgtgccgtaccgcaacgacttcaccgagccggagatcgagcactgg
atccgcttccgtgaggagcacgacgagcagatcaaggccctgaagaagctcatcaacctc
ggcaacgagtacggcctcgacctgtcccgcccggcccagaccgcgcaggaagccgtgcag
tggacctacatgggctacctggcctccatcaagtcccaggacggcgccgccatgtccttc
ggccgcaactccgccttcctcgactgctacatcgagcgcgacctccaggccggcaagatc
accgagaccgacgcccaggagctcatcgacaacatcgtcatgaagctgcgcatcgtgcgc
ttcctgcgtaccaaggactacgattcgatcttctccggcgacccgtactgggcgacctgg
tccgacgccggcttcggcgatgacggccgttcgatggtcaccaagacctcgttccgtctg
ctcaacaccctgaccctcgagcacctcggacctggccccgagccgaacatcaccatcttc
tgggatccgaagctgcctgaggcctacaagcgcttctgcgccaagatctccatcgacacc
tcggccatccagtacgagtccgacaaggagattcgtagccactggggcgacgacgcggct
atcgcatgctgcgtgtccccgatgcgtgtcggcaagcagatgcagttcttcgccgcccgc
gtgaactccgccaaggccctgctgtacgccatcaacggcggccgcgacgagatgaccggc
atgcaggtcatcgacaagggcgtgatcgagccgattaccccggaggccgacggcaccctg
gactacgagaaggtcaagaacaactacgagaaggctctcgagtggctgtccgagacctac
gtcatggccctgaacatcatccactacatgcacgataagtacgcgtacgagtccatcgag
atggccctgcacgacaaggaagtgtaccgcaccctcggctgcggcatgtccggtctgtcc
atcgccgccgactccctcgccgccgtcaagtacgccaaggtctacccgatctacaacaag
gacgcgaagaccctggaaggccacgagtacgagtacgttgagggcgccgacgacgacctg
atcgtcggctaccgcaccgagggcgagttcccggtctacggcaacgacgacgaccgcgcc
gacgacatcgccaagtgggtcgtctccacggtcatgggccaggtcaagaggctcccggtc
taccgcggcgccgtcccgacccagtccatcctgacgatcacctccaacgtcgagtacggc
aagaacaccggttccttcccgtccggccacgccaagggcaccccgtacgctccgggcgcc
aacccggagaacggcatggactcccacggcatgctgccgtccatgttctccgtcggcaag
atcgactacaacgacgctcttgacggcatctcgctgaccaacaccatcacccctgatggc
ctgggccgcgacgaggacgagcgcatcggcaacctggtcggcatcctggacgccggcaac
ggccacggcctctaccacgcgaacatcaacgttctgcgcaaggagaccatggaggacgcc
gtcgagcaccccgaaaagtacccgcacctgaccgtgcgtgtctccggctacgcggtgaac
ttcgtcaagctcaccaaggagcagcagctcgacgtcatctcccgtaccttccaccagggt
gccgtcgtcgactga

DBGET integrated database retrieval system