KEGG   Bifidobacterium longum NCC2705: BL0157
Entry
BL0157            CDS       T00094                                 

Definition
(RefSeq) hypothetical protein
  KO
K24100  galactan exo-1,6-beta-galactobiohydrolase (non-reducing end) [EC:3.2.1.213]
Organism
blo  Bifidobacterium longum NCC2705
Brite
KEGG Orthology (KO) [BR:blo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BL0157
Enzymes [BR:blo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.213  galactan exo-1,6-beta-galactobiohydrolase (non-reducing end)
     BL0157
SSDB
Motif
Pfam: Big_3 F5_F8_type_C RicinB_lectin_2 Big_4 Cadherin-like
Other DBs
NCBI-GeneID: 1021852
NCBI-ProteinID: NP_695376
UniProt: Q8G7T8
Position
1752191..1756909
AA seq 1572 aa
MLGDDFVLKFGHIRMFAQTFWLRRKKSRRRPYIRQRGQRSEAKADFPGMRRIAGTLRRPM
KVLGRSLAAMVAAATLVGGGAFAVAGTAYAADNDAITVTPNPWYANSFDGWGTSLAWFAN
ATGSLGEESAITTNLGDDASKAKAVEYGKQLREQFYQSIFGDEGLDLNMARYNVGGGNAS
DVAYGYPFMRQGAAVPGTWKDDATGSGTYGNGVTTKQADKDKLAAAFDPTDDNQYDFSKS
AAQDWWIERGATGDNPDITDVEAFANSAPWFLTNSGYATGGRNSGSNNLANPEKFAQYMA
KNVEHLESLGANVDTVEPFNESETSYWGTPGDMASKYTDESDDNTKLINNYWDKYYSDKD
KSVTPYSNALKKPQEGMHVSNAQQQQTITALAEALKDNDDTIIAATDATNSADFVKSYNQ
YPQAIKDLIGQYNVHAYSDSNQMQSRDIAQADGKKLSMSEVDGSWQSGSYNPYGFDNALG
MMSKISSNVTRLQSKDFTFWQVVEDLYNMQMGSNVNPAGENTNWGTVLIDFDCTVAGMDG
KLYSERRVNNNGGTTEGLAPCTVIANAKYNGVKAITHFIHAGDKVIANNDEDNNMTATSA
DGKTQTVVHRNSGTSDQTFVIDLSKYGEIADNASGELYLTTETSAEDKNAGVDSATPEVF
AKTSNVKQAEGSVVIDKAAKTATVTVPARSIASIQLTGVTGYAKDAAVETGDTYQLVGKQ
SGKAVADTTSGDSALSLANVASDAENAKKQIWTFTQIEQPADSERPDLKAYVITNAEGKV
LVSKDGTNALSDETVEAAKSDPAAKWILNTSDGSTYQLLNAATKTNLDVDNSGTAVGTKV
GLWQSPSGTSPSANQTWTLRNVTPTGQKTVNVQTAVNEKAALPTEVTLYYTWGEGKATVA
DWDTSKVDVAKEGTYEATATAADVYGNEFNVTATVYVGAFTVSDPVSATVLAGTSASNAK
AALEAEPVYLHVKASPAFEGDAAKVTWNFDGLDAKLAEAKAGDNIAVAGTYQLDDTTTIA
LKGTIYVTAATPENVADTASNLTVTNQQTEYSKGDQWKKLTDDDTSAEAWVTWNAKNDYS
ASPTATVNFGEEREVTGLTITYGDKAPASAKAEYTTDGTTWTQFGSEVKPKAGQTVTFTP
EDGSLKATQVRIVNTQNGDFMNATEIEAFVVPVVGGVKNIAAASGTNFSVNFQEGASASK
AIDGDTTSKGWSTWASTASTVDPVATFTFDEAQTITEVKTFFYYDGRASWPKSQTLEYQD
EAGEWHGVGTKDGWKTQAGDAGSGSDGITAADTPTVDFVLDTPVKAKAIRLTNTLQDTKV
YINVAEIQVFAQDNKVITPQPASDATLGDLRLDGETIKGFAADKTDYTVDLPFGAEANPV
LQAFATDNAAAVKVTGDAVENGKLGGKAAITVTSADESETKTYTVTFNAFTLASLKVIGP
TKTEYAIGDKLDTAGLKVTAVYQSGDKTKEVPVALDDPQLAIGSFDSTTAGKKAITVSYR
GVTATFNVTVKANAVAPGPEEQKPGSTNKPGATGNGNKNTVANTGSNVAAIAGAVALLAA
AAGALFMLRKRA
NT seq 4719 nt   +upstreamnt  +downstreamnt
ttgttgggtgatgattttgtgctaaaatttggtcatatcagaatgtttgcgcaaacattc
tggctgcgccggaaaaagagccggcgtaggccgtatatcaggcaaagaggccagcgcagt
gaagcaaaggccgattttcccggtatgaggcggatagcaggaacactaaggagaccaatg
aaggtactgggcagatcgcttgctgcaatggttgcggcggcaacactagtgggaggaggg
gcgtttgcggttgccggcactgcgtatgcggctgataacgatgccattaccgtgaccccg
aacccgtggtatgccaacagtttcgatggctggggcacctcgctggcttggttcgccaac
gccaccggcagcctcggcgaggaatcggccatcaccaccaatctcggcgatgacgcttcc
aaggctaaggctgtggaatacggcaaacagctgcgcgaacagttctaccagtccatcttc
ggtgatgaaggactggacctgaacatggcccgctacaacgtgggcggcggcaatgcctcc
gatgttgcctacggctacccattcatgcgccaaggcgctgccgtgcctggcacgtggaaa
gatgacgccaccggctccggcacgtatggcaatggcgtaaccaccaagcaggccgacaaa
gacaagctggctgcggcattcgacccgactgacgacaaccagtatgacttctccaagtcc
gccgcccaagactggtggattgagcgcggtgccaccggcgataaccctgacatcaccgac
gtagaggccttcgccaactccgctccgtggttcctgaccaacagcggttacgccactggt
ggacgcaactccggtagcaataatcttgcaaaccctgagaaattcgctcagtacatggcc
aagaacgtcgagcacctcgaaagccttggcgcaaacgttgacacggtcgagccgttcaac
gagtccgagaccagttactggggcactccgggcgacatggcttcgaagtacaccgatgag
agcgatgacaacaccaagctcattaacaactactgggataagtactactccgacaaagat
aagtccgtcaccccatactccaacgcgctgaagaagccgcaggagggtatgcatgtcagc
aacgcccagcagcagcagacgattaccgcactcgctgaggcgctcaaggacaatgatgac
accatcatcgcagccaccgatgccacgaactccgccgacttcgtcaagtcgtacaaccag
tacccgcaggcgatcaaggaccttatcggccagtacaacgttcacgcctactccgacagc
aaccagatgcagtcgcgcgatatcgctcaggcagacggcaagaagctgtcgatgagcgag
gtggacggctcctggcagtctggctcctacaacccgtacggtttcgacaacgcgctgggc
atgatgagcaagatcagctccaacgtcacccgcctgcagtccaaggacttcaccttctgg
caggtggtcgaggacctctacaacatgcagatgggctcgaatgtgaatccggccggtgag
aacaccaactggggcaccgtgctcatcgacttcgactgcaccgtggctggcatggacggc
aagctctactccgagcgccgcgtgaacaacaacggcggaaccaccgaggggctcgctccg
tgcacggttatcgccaacgccaagtacaacggcgtcaaggccatcacccacttcatccac
gcgggcgacaaggtcatcgccaacaatgacgaagacaacaacatgaccgccacctccgcc
gatggcaagacgcaaaccgtcgtccaccgcaactccggcacctccgatcagaccttcgtc
atcgacctgtcgaagtacggcgagattgccgacaatgcttccggcgagctctacctgacc
accgaaacctctgccgaagacaagaacgcgggcgtcgattccgccaccccggaagtcttc
gccaagaccagcaatgtcaagcaagctgaaggttctgtggtgattgacaaggctgccaag
accgctacggtcactgtgcccgcccgttctatcgcctccatccagctcactggcgtgacc
ggctacgctaaggatgctgccgtcgagaccggcgacacttaccagctcgttggtaagcag
tccggcaaggccgtggctgataccacttctggtgattccgcgctgtccctggccaacgtc
gcttccgatgccgagaacgccaagaagcagatctggacctttacccagatcgagcagccc
gccgactccgagcgccctgatctcaaggcttatgtgattaccaacgccgaaggcaaggtg
ctggtttccaaggacggcacgaatgcgctttccgacgagacggttgaggccgccaagtcc
gacccggctgccaagtggattctcaacacttccgatggttcgacctaccagctgctcaat
gctgcgactaagacgaacctcgatgtggataactctggcaccgcagttggcacgaaggtt
ggcctgtggcaatcgccgagcggcacttcgccatccgccaatcagacctggacgttgcgc
aatgtaacgcctaccggccagaaaaccgtgaacgtgcagaccgccgttaacgagaaggcc
gcgctgccgaccgaagtcacgctctactacacctggggcgaaggcaaggccacggtcgcc
gattgggatacttccaaggtcgatgtggccaaggaaggcacctacgaggccaccgccact
gccgccgacgtatacggcaatgagttcaacgtcaccgccacggtctacgttggtgccttc
actgtttccgatccggtatccgccacagtgctggccggcaccagtgcaagcaacgccaag
gctgcgcttgaggctgagccggtgtacctgcacgtcaaggcatcgcctgcatttgaaggt
gatgcggctaaggttacttggaacttcgatgggcttgatgccaagctcgccgaggccaag
gctggcgacaacattgccgtggccggtacctaccagctggacgacacgaccacgattgcg
ctgaagggtacgatctatgtcaccgccgccacgcctgagaatgtggccgacactgcttcc
aacctgactgtgaccaaccagcagacggaatacagcaagggcgaccagtggaagaagctc
accgatgacgatacgtcggccgaggcttgggtgacgtggaacgcaaagaatgattactct
gccagcccgaccgccacggtgaacttcggcgaagagcgagaagtcaccggcctgaccatc
acctatggtgacaaggctccggcatccgccaaggctgagtacaccactgatggcaccaca
tggacgcagttcggcagcgaggtcaagcccaaagccgggcagactgttacgttcactcct
gaagatggttcactcaaggccacgcaggtgcgtatcgtcaacacgcagaacggcgacttc
atgaacgctaccgagatcgaagcctttgtggttccggttgtcggaggcgtgaagaacatc
gccgcggcctctggcacgaacttctcggtgaacttccaggagggtgcctccgcttccaag
gccatcgatggtgacactacgtcaaagggttggtccacttgggcttccaccgcctcgacg
gtggacccggtcgccacgttcaccttcgacgaagctcagaccatcaccgaagtgaagacc
ttcttctactacgatggtcgtgcgtcttggccgaagagccagacgctggaataccaggat
gaggctggcgaatggcatggagtcggtaccaaggatggctggaagacacaggccggcgat
gccggctctggctccgacggcatcaccgccgccgacaccccgaccgttgacttcgtgctc
gacaccccggtaaaggccaaggccatccgcctgaccaacacgttgcaggacaccaaggtg
tacatcaacgtggctgagatccaggtgttcgcacaagacaacaaggtgattaccccgcag
ccggcatccgatgccacgctgggcgacctgcgtcttgacggcgagaccatcaagggcttc
gctgctgataagaccgactacacagttgatcttccgttcggtgctgaggcaaacccggtg
ctgcaggccttcgccaccgacaatgccgccgccgtcaaggtgactggcgacgcggttgag
aacggcaagcttggcggcaaggccgccattacggtgacctcagccgacgagtctgagacg
aagacctacacggtgaccttcaacgccttcactttggcttcgctcaaggtgatcggaccc
acgaagaccgagtacgccatcggcgacaagctcgataccgccggtctgaaggtgactgcc
gtctaccagagtggcgacaagaccaaggaagtgccggtcgctcttgacgacccgcagctt
gcgattggctcgttcgactccaccaccgcaggcaagaaggcgattaccgtctcctaccgt
ggtgtgaccgcgaccttcaacgtcacggtcaaggccaacgcagtcgcccctggccctgaa
gaacagaagcccggcagcaccaacaagcccggtgccaccggcaacggcaacaagaacacg
gtggccaacaccggttccaatgttgccgccatcgctggcgctgtcgctctgctggccgct
gccgcgggtgcattgttcatgctgcgcaagcgtgcatag

DBGET integrated database retrieval system