KEGG   Bifidobacterium longum NCC2705: BL0259Help
Entry
BL0259            CDS       T00094                                 

Gene name
bgaB
Definition
(RefSeq) beta-galactosidase I
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BL0259 (bgaB)
Enzymes [BR:blo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BL0259 (bgaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 Cellulase
Motif
Other DBs
NCBI-GeneID: 1023317
NCBI-ProteinID: NP_695465
UniProt: Q8G7K5
Position
complement(1171511..1173643)
Genome map
AA seq 710 aa AA seqDB search
MTTHRAFRWPSLLTESGRGIAFGGDYNPDQWPEETLDEDIRLMGEAGVNVVSLAIFSWDK
IEPVEGAFTFEWLDHVIDRLGRAGIAVDLASATAAAPLWLYESHPEVLPVDRYGHTVNAG
SRQSWQPTSPVFKEYALRLCRRLAEHYKDNPYVTAWHMGNEYGWNNRYDYSDNALAAFRT
WCEAKYGTIDALNEAWGTAFWSQHVNSFDEVLLPRHMGGDAMVNPSQQLDYERFGNDMLL
DFYKAERDAIEQICPDKPFTTNFMVSTDQCVMNYAKWADEVDFVSNDHYFHEGESHLDEL
ACSDALMDSLALGKPWYVMEHSTSAVQWKPLNTRKRAGELMRDSLAHVAMGADAICFFQW
RQSKSGAEAFHSAMLPHAGADSKVFRGVCELGKALKTLSDAGLQGTELERAGTAILFSAE
SEWATRSETLPSMKLNHWHDVRDWYRGFLDAGLRADVVPLAYDWTGYKTIVLPTVLSLSD
EDVLRIADFAKAGGTVIVGYAAGLIDEHFHIGLGGYPGAGNGLLRDMLGIRSEEFNILGE
EAEGEPSEISLSNGLTTRLWQNDVTSVAADTTVLASYAGESAADWELERTPAITSRPYGN
GTAIYVGCDLNRHDIAQLLKALGSRWQELSAQPTESGQTPTYPTTDPRILHTIRRSADGS
TRFDFYLNRSNQPVAVNGIEGEPIIAYRCEADTTGYTLNRNAILIAKASC
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgactactcatagagcatttaggtggccgtccctgctgacggaatccggccgcggcatc
gcgttcggcggcgactacaacccggaccagtggcccgaggagacgctggacgaggatatc
cgtctcatgggtgaggccggcgtgaacgtcgtatcgctggcaattttcagctgggacaag
atcgagccggtcgagggcgcgttcacgttcgagtggctcgaccatgtgatcgacaggctc
ggcagagccggcatcgccgtggacttggcctccgccacagccgccgcgccgctgtggctg
tacgaatcccatccagaggtgctgccggtagaccggtatggtcataccgtcaacgcgggc
tcacgccagtcgtggcagccaacaagcccggtgttcaaggaatacgcgctgcgcctgtgc
cgcagacttgccgaacactacaaggacaacccgtatgtgaccgcctggcacatgggcaac
gaatacggctggaacaaccgctacgactactccgacaacgccttggccgcgttccgcacg
tggtgcgaggccaagtacggtaccatcgacgcgttgaacgaggcgtggggcacggccttc
tggtcgcagcacgtgaacagtttcgacgaggtgctgctgccacgtcacatgggcggcgac
gccatggtcaacccgtcgcagcagttggattacgagcggttcggcaacgacatgctgctc
gacttctacaaagccgaacgcgacgccatcgagcagatctgccccgacaagccgttcacc
acgaacttcatggtctccaccgaccagtgcgtcatgaactacgccaaatgggcggatgag
gtggacttcgtgtccaacgatcactacttccatgagggcgaatcccacctggacgaactc
gcctgctcggacgcgctcatggactccctcgcgctgggcaagccgtggtacgtgatggag
cactccacctcagccgtgcagtggaagccgctgaacacacgcaaacgggccggcgaactc
atgcgcgactccctggcccacgtggccatgggcgccgacgccatctgctttttccaatgg
cggcaatccaagtcgggcgccgaggcgttccactccgccatgctgccccacgcgggtgcc
gattccaaggtcttccgcggcgtatgcgagctcggtaaggcgctgaagaccctctccgac
gccgggctgcagggcactgagctcgagcgtgccggcacggcgatcctgttcagcgcggaa
tccgaatgggccacacgctccgaaaccctgcccagcatgaaactcaaccactggcacgac
gtgcgcgactggtaccgcggcttcctggatgccgggctgcgcgcggacgtggtgccgctc
gcctacgactggaccggctacaaaaccatcgtgctgcccaccgtgctcagcctgtccgac
gaagacgttctccgtatcgccgacttcgcgaaggccggcggaaccgtcatcgtcggctat
gccgccggcctgatcgacgagcacttccacatcggcctcggcggctaccccggcgccggc
aacgggctcctacgcgacatgctcggcatccgctccgaagaattcaacatcctcggtgaa
gaagccgaaggcgagcccagcgaaatcagcctgtccaatggtctgacgacccgcctgtgg
cagaacgacgtgacttccgtagccgcggacaccacagtgcttgcctcttacgcaggtgag
tccgccgccgactgggagctggagcgcacccccgccatcaccagccgcccctatggcaac
ggtaccgccatctacgtgggctgcgacctcaaccgtcacgacattgcccagttgctcaaa
gcacttggctcccgatggcaggagttgtcggcgcagccgactgagagtggtcaaactcca
acctatcccaccacagatccccgcatcctgcacaccatccgccgatccgcagacggctcc
acccgcttcgatttctacctcaaccgctcaaaccagcccgttgccgtcaacggcattgag
ggagaaccaatcatcgcctaccgttgcgaggccgacaccaccggctatacgctgaaccgc
aatgccattcttattgctaaagcgtcctgctag

DBGET integrated database retrieval system