KEGG   Bifidobacterium longum NCC2705: BL0708Help
Entry
BL0708            CDS       T00094                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00010  Glycolysis / Gluconeogenesis
blo00051  Fructose and mannose metabolism
blo00562  Inositol phosphate metabolism
blo01100  Metabolic pathways
blo01110  Biosynthesis of secondary metabolites
blo01120  Microbial metabolism in diverse environments
blo01130  Biosynthesis of antibiotics
blo01200  Carbon metabolism
blo01230  Biosynthesis of amino acids
Module
blo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL0708 (tpiA)
   00051 Fructose and mannose metabolism
    BL0708 (tpiA)
   00562 Inositol phosphate metabolism
    BL0708 (tpiA)
Enzymes [BR:blo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BL0708 (tpiA)
Exosome [BR:blo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BL0708 (tpiA)
  Exosomal proteins of bladder cancer cells
   BL0708 (tpiA)
  Exosomal proteins of melanoma cells
   BL0708 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM AAA_26
Motif
Other DBs
NCBI-GeneID: 1023266
NCBI-ProteinID: NP_695891
UniProt: Q8G6D5
Position
486948..487751
Genome map
AA seq 267 aa AA seqDB search
MASKRIPLVAGNWKMNFDHLEATYFVQKLVWLLRDAHFDFKRCEVALFPSFTSLRSVQVL
VEADKLHVAYGAQSVSVTTQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDANIVD
QVRAVLAAGMQPILCVGESFEERRQGIELDFAVGQVRDVTRDLNEEQAAKLIVAYEPVWA
IGTGMVATPQSAQDAANAIRNDLKTTFGTKVSDSVRILYGGSVTSKNAAELISQPDVDGF
LIGGAALDVEELAKIARLALKSTKSRN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaacgcattccgttggtggccggcaactggaagatgaatttcgaccatctt
gaagccacttacttcgtgcagaagctggtatggctgttgcgtgacgctcacttcgacttt
aaacgctgcgaagtcgcgcttttcccctcgttcacgtcattgcgcagcgtgcaggtgctg
gtcgaagccgacaagctccatgtcgcctacggcgcacaatccgtttccgtgaccacccaa
ggtgccttcaccggcgatgtgtccgcggacatgatcgcccatctcggctgctcatacgtc
atcgtcggccactccgaacgccgcaaataccatcctgaagatgacgccaatatcgtcgat
caggtacgtgctgtgctcgccgccggcatgcagccgattttgtgcgtcggcgaaagcttc
gaggaacgacgtcaaggcattgaactcgatttcgccgtgggccaggtacgagacgtcacc
cgcgatctcaacgaagaacaagccgccaaactcatcgtggcctacgaacctgtctgggcc
attggcaccggcatggtggccactccgcaatccgcccaggatgccgcaaacgccatccgc
aacgatttgaagaccacttttggcacgaaggtatccgatagcgtacgtatcctgtacggc
ggatcggtcacctcgaaaaatgcggcggaactcatttcccagcccgacgttgacggcttc
ctgatcggaggggcggccctggacgttgaggaactcgccaaaatcgctcgactggcactg
aaatccacgaaatcacggaactaa

DBGET integrated database retrieval system