KEGG   Bifidobacterium longum NCC2705: BL1103Help
Entry
BL1103            CDS       T00094                                 

Definition
(RefSeq) low specificity-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00260  Glycine, serine and threonine metabolism
blo01100  Metabolic pathways
blo01110  Biosynthesis of secondary metabolites
blo01120  Microbial metabolism in diverse environments
blo01130  Biosynthesis of antibiotics
blo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BL1103
Enzymes [BR:blo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BL1103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 1022648
NCBI-ProteinID: NP_696275
UniProt: Q8G5B2
Position
937281..938306
Genome map
AA seq 341 aa AA seqDB search
MLSFENDYSRAAHPAVLEAVAEANNHLYSGYGSDELSDQAKAKIREACGQPDADVWFLVG
GTQTNQVVIDTITPAYAGVVAVASGHPNVHEAGAIEFSGHKVLTIPQHNGKMDPTELDEF
CKTFYADGNYEHMVFPGSVYVSQSTEYGTIYSKAELQAIADVAHKYDMPLFVDGARLGYA
LTATGSDMTLADLATIADVFYIGGTKVGALFGEAVVFTKHNTPKHFLTLIKQHGALLAKG
FVLGAQFDALFTDNLYFKIARNANEAADRIREALRAKGYTLTFEAPTNQIFVTMDQPTID
RLEREIKLGFTEKADDTHTVMRICTSWATTPEEVDQLIELL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcttttgagaacgattactcccgcgccgcccatcccgcggtgcttgaagccgtg
gctgaagccaacaaccatctgtattcgggctacgggtccgacgaactgagcgatcaggcc
aaggccaagatccgcgaggcctgcggccagccggacgcggatgtgtggttcctcgtcggc
ggcacgcagaccaaccaggtcgtcatcgacaccatcaccccggcgtatgcaggcgtggtc
gcggtcgcctccggccatccgaacgtgcacgaggccggcgccatcgagttctccgggcac
aaggtgctcacgattccccagcacaacggcaaaatggacccgaccgaactggacgagttc
tgcaagaccttctatgcggacggcaactacgagcacatggtgttcccgggctccgtgtac
gtctcgcaaagcaccgaatatggcaccatctactccaaggccgagttgcaggccatcgcc
gatgtggcgcacaagtacgacatgccgctgttcgtggatggcgcgcgactcggctacgcg
ctgaccgccaccggttcagacatgacgctcgcggatctggcgaccatcgccgacgtgttc
tacatcggcggtaccaaggtgggtgccctgttcggcgaggccgtggtgtttaccaagcac
aacacgccgaagcacttcttgaccctcatcaagcagcacggtgccttgctggccaagggc
tttgtgctgggcgcgcagtttgacgctttgttcaccgacaacctgtatttcaagatcgcc
cgcaacgccaatgaggcggccgatcgtattcgcgaggccctgcgcgccaagggctacacg
ctcactttcgaagcgcccaccaaccagattttcgtgacgatggatcagccgaccatcgac
cgtctggagcgcgagatcaagctcggctttaccgaaaaggccgacgacacgcacaccgtg
atgcgcatctgcaccagctgggccaccacgcctgaagaggtcgatcaacttattgagttg
ttgtaa

DBGET integrated database retrieval system