KEGG   Bifidobacterium longum NCC2705: BL1280Help
Entry
BL1280            CDS       T00094                                 

Gene name
dapE
Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00300  Lysine biosynthesis
blo01100  Metabolic pathways
blo01120  Microbial metabolism in diverse environments
blo01230  Biosynthesis of amino acids
Module
blo_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BL1280 (dapE)
Enzymes [BR:blo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BL1280 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 1022766
NCBI-ProteinID: NP_696445
UniProt: Q8G4U4
Position
1895991..1897265
Genome map
AA seq 424 aa AA seqDB search
MYSAAKSHVVSVLGPPPTRYAVHMTLELNRTASTAEQLNSLLTQIMENFSVSDHEGPLTD
EVEAFLNEQEHLTVRRHGDTVVASTDFGKPSRVILAGHLDTVPVIDNFPPKWLEPGDSLI
REEIAHAHPEDRVLWGRGATDMKASDAVMLYLAATLDGRTPETTPKVDLTYVFYDHEEVV
AEKNGLRKVVEAHPDWTTGDFAIIGEPTNSGIEGGCNGTIRFDVVTHGVAAHSARAWMGE
NAIHKAADILNRLNAYEPATVNVDGLDYREGLNATLISGGKGTNVIPDECRVHVNYRFAP
DKSLAEAKALMMGADAGAELGNGEHVATGGVFEGYGIEMKDESPSARPGLNAPLAQDLVR
LVKERTGRDPLAKLGWTDVARFSQLGIPAVNLGAGDPLLAHKHDEQVPESDLTAMAAILT
DWLV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtattcggccgcaaaatctcatgtagtgagtgtgctgggcccgccgcccacgcggtac
gctgttcacatgacgcttgaattgaaccgcaccgcatccactgccgagcagctgaacagc
ctgctcacccagatcatggagaacttctccgtgtccgaccacgagggccccctcaccgac
gaggtcgaggccttccttaacgagcaagagcacctgaccgtccgccgtcacggcgacaca
gtggtggccagcaccgacttcggcaagccgagccgtgtgatcttggccgggcacctcgat
actgtgccggtcatcgacaatttcccaccaaagtggctggagcccggcgattcgctgatt
cgcgaagaaatcgcccacgctcatcccgaagaccgcgtgctgtggggccgcggtgccacc
gatatgaaggcctccgacgcggtgatgctctacctcgccgccacgctcgacggccgcacg
ccggaaaccaccccgaaagtcgacctcacctacgtcttctacgaccatgaggaagtcgtc
gccgaaaagaatggcctacgcaaagtcgtcgaggcccatcccgattggaccaccggcgat
ttcgccatcatcggcgagcccaccaacagcggcatcgagggcggttgcaacggtacgatt
cgcttcgacgtcgtaacccacggcgtggccgcgcactccgcccgtgcatggatgggggag
aacgccatccacaaggcggccgacattctgaaccgactcaacgcctacgagccggccacc
gtgaacgtggacgggctcgattatcgcgagggcctcaacgccacgctgatctccggcggc
aaaggcacgaacgtcattccggatgaatgccgcgtacacgtcaactaccgcttcgccccg
gacaagtcgttggccgaggccaaggctctgatgatgggcgcggacgccggtgccgaactc
ggcaatggcgagcatgtggctaccggcggcgtgttcgagggctacggcatcgaaatgaag
gacgaaagcccctccgcgcgcccgggcctgaacgccccgctcgcccaggatctggtccga
ctggttaaggagcgcactggccgcgacccgctggccaagctcggctggaccgacgtggca
cgcttctctcagctcggtatcccggccgtcaacctcggtgccggcgatccgctgctggct
cacaagcacgacgagcaggtgcctgaatccgacctgaccgccatggccgcaatccttacc
gactggctggtctga

DBGET integrated database retrieval system