KEGG   Bifidobacterium longum NCC2705: BL1308Help
Entry
BL1308            CDS       T00094                                 

Gene name
ldh2
Definition
(RefSeq) lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00010  Glycolysis / Gluconeogenesis
blo00270  Cysteine and methionine metabolism
blo00620  Pyruvate metabolism
blo00640  Propanoate metabolism
blo01100  Metabolic pathways
blo01110  Biosynthesis of secondary metabolites
blo01120  Microbial metabolism in diverse environments
blo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:blo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL1308 (ldh2)
   00620 Pyruvate metabolism
    BL1308 (ldh2)
   00640 Propanoate metabolism
    BL1308 (ldh2)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BL1308 (ldh2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:blo04147]
    BL1308 (ldh2)
Enzymes [BR:blo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     BL1308 (ldh2)
Exosome [BR:blo04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   BL1308 (ldh2)
  Exosomal proteins of breast milk
   BL1308 (ldh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C F420_oxidored Glyco_hydro_4 3HCDH_N Sacchrp_dh_NADP UDPG_MGDP_dh_N DAO AlaDh_PNT_C Pyr_redox_2 NAD_Gly3P_dh_N ApbA ThiF NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 1022790
NCBI-ProteinID: NP_696472
UniProt: P0CW93
Structure
PDB: 

Position
184467..185429
Genome map
AA seq 320 aa AA seqDB search
MAETTVKPTKLAVIGAGAVGSTLAFAAAQRGIAREIVLEDIAKERVEAEVLDMQHGSSFY
PTVSIDGSDDPEICRDADMVVITAGPRQKPGQSRLELVGATVNILKAIMPNLVKVAPNAI
YMLITNPVDIATHVAQKLTGLPENQIFGSGTNLDSARLRFLIAQQTGVNVKNVHAYIAGE
HGDSEVPLWESATIGGVPMCDWTPLPGHDPLDADKREEIHQEVKNAAYKIINGKGATNYA
IGMSGVDIIEAVLHDTNRILPVSSMLKDFHGISDICMSVPTLLNRQGVNNTINTPVSDKE
LAALKRSAETLKETAAQFGF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaactaccgttaagcccacgaagcttgctgttattggtgccggtgccgttggc
tccaccctcgccttcgccgctgcccagcgtggcatcgctcgcgagatcgtgcttgaagac
atcgccaaggagcgcgtggaagccgaagtgctcgacatgcagcatggctccagcttctac
ccgaccgtgtccatcgacggttccgacgatcctgagatctgccgcgacgccgacatggtc
gtcatcaccgctggtccgcgtcagaagccgggtcagtctcgtcttgagctcgttggcgct
accgtcaacatcctcaaggccatcatgccgaacctggtcaaggtggctccgaacgccatc
tacatgctcatcaccaacccggtcgacatcgctacccacgtggctcagaagctcaccggt
ctgcccgagaaccagatcttcggttccggcaccaacctggactccgctcgtctgcgcttc
ctgattgcccagcagaccggcgtcaacgtcaagaacgtgcacgcctacatcgccggcgag
cacggcgactccgaagtcccgctgtgggagtccgccaccatcggtggcgtccccatgtgc
gactggaccccgctgcccggccacgatccgctcgacgccgacaagcgcgaggagatccac
caggaagtcaagaacgccgcttacaagatcatcaacggtaagggtgccaccaactacgcc
atcggcatgtccggcgtcgacatcatcgaagccgtcctgcacgacaccaaccgcatcctg
cccgtgagctccatgctcaaggacttccacggcatctccgacatctgcatgtccgtgccg
accctcctcaaccgtcagggcgtcaacaacaccatcaacaccccggtctccgacaaggag
ctcgccgctctgaagcgctctgccgagacgctgaaggaaaccgccgcccagttcggcttc
tga

DBGET integrated database retrieval system