KEGG   Bifidobacterium longum NCC2705: BL1526Help
Entry
BL1526            CDS       T00094                                 

Gene name
agl
Definition
(RefSeq) oligo-1,6-glucosidase
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00052  Galactose metabolism
blo00500  Starch and sucrose metabolism
blo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BL1526 (agl)
   00500 Starch and sucrose metabolism
    BL1526 (agl)
Enzymes [BR:blo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     BL1526 (agl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C hDGE_amylase Alpha-amylase_C
Motif
Other DBs
NCBI-GeneID: 1021690
NCBI-ProteinID: NP_696682
UniProt: Q8G467
Position
1701071..1702891
Genome map
AA seq 606 aa AA seqDB search
MTTSQRTVIPDSIRTNGATPNPWWSNAVVYQIYPRSFQDTNGDGLGDLKGITSRLDYLAD
LGVDVLWLSPVYKSPQDDNGYDISDYQDIDPLFGTLDDMDELLAEAHKRGLKIVMDLVVN
HTSDEHAWFEASKNKDDEHADWYWWRPARPGTTAGEPGAEPNQWGSYFGGSAWEYCPERG
EYYLHQFSKKQPDLNWENPAVRRAVYDMMNWWLDRGVDGFRMDVITLISKRTDLSGKLPG
EYGSELDDLPVGEEGYSNPNPFCADGPRQDEFLAEMRREVFEGREGFLTVGEAPGVTAQR
NEYITDPANGELDMLFLFEHVDFDCEGVKWKPLPLDLPKLKSIMAGYQAAVKNAGWASLF
TGNHDQPRVVSRWGDDSSEESRVRSAKALGLMLHMHRGTPYIYQGEELGMTDAHFTRLDQ
YRDLESLNAYRQRVEEAKVQSPESMLAGIAARGRDNSRTPMQWDGSVYAGFTAPDAAKEP
WISVNPNHAAINAVGEFDDPDSVYAFYKQLIALRHDMPVVAAGDWHLLDADDAHVYAFTR
TLGDEKLLVVVNMSGRTVDLPRETAELAAAGITESNVVISTYDAPHAVASLANRELDPWE
AAVIQL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttcacaacgcacagtaattccagattccatccgcaccaacggtgccacccca
aatccgtggtggtccaatgcggtcgtttaccagatttacccgcgttccttccaagacacc
aacggcgacggcctcggcgatctcaagggcattacgtcacggctcgactatctggccgac
ctcggcgtggatgtgctgtggctatccccggtatacaagtctccgcaagacgataatggc
tacgatatttccgactatcaggacattgatcctctgttcggcacactcgacgacatggat
gagctgctggccgaggcccacaagcgcgggctcaagatcgtgatggatcttgttgtcaat
cacacttccgatgaacacgcctggtttgaagcgtccaaaaacaaggatgatgagcacgcc
gactggtattggtggcgtcccgcccgtcccggcaccactgccggcgagcccggtgccgag
cccaaccagtggggctcctactttggcggttctgcatgggagtattgccctgagcgtggc
gaatactacctgcatcagttctcgaagaagcagccggacctcaactgggaaaatccggct
gtgcgccgcgcggtatacgacatgatgaactggtggcttgaccgcggcgttgacggcttc
cgcatggatgtgattacgctgatttccaagcgcacggacctgtctggcaagctgcccggc
gagtacggttccgagctggacgatctgcccgtgggtgaggaaggctattccaacccgaat
ccgttctgcgcggacggccctcgccaagacgaattcctggccgaaatgcgccgtgaagtg
ttcgaaggccgtgagggcttcctcaccgtgggcgaggctcccggcgttaccgcacagcgc
aacgaatacatcaccgaccccgccaacggcgagctggacatgctcttcctattcgagcac
gttgattttgactgcgaaggcgtcaaatggaagccactgccacttgacctgccgaagctc
aagagcattatggccggttatcaagcggccgtgaagaatgcaggctgggcaagcctgttt
actggtaaccacgaccagcctcgcgtcgtttctcgttggggtgatgactcctcggaggaa
tctcgtgtgcgttcggccaaggcacttggcctgatgctgcacatgcatcgcggcaccccg
tacatatatcagggcgaagagctaggcatgaccgacgcccacttcacgcgcctagaccag
taccgtgacctcgagtccctgaacgcttaccgtcaaagggttgaggaagccaaagtgcag
tcgcccgaatcgatgttggcgggtatcgccgcgcgcggtcgtgataattcgcgtaccccg
atgcaatgggacggctctgtctatgccggtttcactgcgccggatgccgctaaggagcca
tggatctccgtcaatcccaaccatgcggcgatcaacgcggtcggcgaattcgacgatccg
gattcggtatatgccttctacaagcagctcatcgcgctgcgccacgacatgcctgtcgtg
gcggccggcgactggcatctgctcgatgcggatgacgcgcatgtctacgccttcacccgc
accctcggcgatgagaagctgctggtcgtggtcaacatgtccggccgaaccgttgatcta
ccgcgcgaaaccgccgaactggccgccgccggaatcaccgagtcgaacgtggtaatcagc
acgtatgatgccccgcacgccgtggcctccctcgccaaccgtgagctcgatccttgggag
gccgccgtcattcagctgtag

DBGET integrated database retrieval system